KEGG   Litorilituus sediminis: EMK97_10355Help
Entry
EMK97_10355       CDS       T05852                                 

Definition
(GenBank) acyltransferase
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase Acyltransf_C
Motif
Other DBs
NCBI-ProteinID: QBG36082
UniProt: A0A4P6P931
Position
complement(2324234..2325151)
Genome map
AA seq 305 aa AA seqDB search
MLNFLPAPIIGFLSLAFYLINTLLWLAPILVFSLLKALFPFKVTQKVFSYLLDLMASNWV
ALNSVNQKLFTKMELDVSGLEELNMKDWYLVLANHQSWVDIVVIQRALHGKIPFLKFFLK
KELIYVPIMGLAWWALDFPFMKRYSQSFLKKNPHLRGKDIETTRKACAKFKHKPVSVMSF
IEGTRFTQAKHDKQNSPFKHLLKPKAGGIAFVLDAMSEHLTKIVDITIYYPDGVPNFVDF
LCGRVKNVHIEVHTREISKEISGDYFNDRTYKIAFQKWLTQFWHDKDDRLEQLIEKNTIE
HRKVE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcttaattttttacctgcgcctattattggcttcctttctttagctttttatttgata
aacaccttgttgtggttagcgccaattttggttttctctttattgaaggcgctatttcca
tttaaagtaacgcagaaagtatttagttatttgctggatttaatggcaagtaattgggtg
gcacttaatagtgtaaatcaaaagctgtttactaaaatggagcttgatgtctcaggttta
gaagagctcaatatgaaagactggtacctagtgttggctaatcaccaaagttgggtagat
attgttgtcattcaaagagctttgcatggcaaaatcccttttttaaaattctttctgaaa
aaagagttaatttatgtgcccattatgggcttagcgtggtgggcattagattttccattt
atgaagcgctatagccagtcgtttttgaagaaaaacccgcacttacgtggcaaagatatt
gaaaccacgcgtaaagcctgcgcaaaatttaaacataaacctgttagtgtcatgagtttt
attgaaggaacacgctttacccaagcaaagcatgacaaacaaaactcaccatttaagcat
ttactaaagcctaaagccggtggcatagcctttgtgcttgatgccatgagtgagcattta
actaaaattgttgatatcactatatattatcctgatggcgtaccaaattttgttgatttt
ttatgtgggcgagtgaaaaatgtccatattgaagtacacactagagaaatatcgaaagaa
attagtggtgactactttaatgacagaacatacaaaatagcgtttcagaagtggcttaca
caattttggcatgataaagatgataggcttgagcaactaatagaaaaaaatactattgag
cacaggaaagtggaatga

DBGET integrated database retrieval system