KEGG   Litorilituus sediminis: EMK97_12305Help
Entry
EMK97_12305       CDS       T05852                                 

Definition
(GenBank) hypothetical protein
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRAM_2
Motif
Other DBs
NCBI-ProteinID: QBG36443
UniProt: A0A4P6P4Q5
Position
complement(2764484..2765902)
Genome map
AA seq 472 aa AA seqDB search
MHLKTISLISICSLITACGGGGSSSTTPDNSNSGTNTSNTLSLVAKYKDACGNEVLASDA
ALLIHNEDYSNKEIITADQNGKLTYQSTNSTQTISIVMPGQNKVGNITPINIATFIDYPI
KDMGEFIDYTYETDACSCQTFNLQVSTPARANDIGQGKIFGIEGAANISSYRGQNHFDNF
MVCKKQSGDWPLVSTIINFDSPSESFAAYIPDIANTTVINAENQGKIVDISTNDYSANKR
VTTVINELNSLRSYTFDSSQNVYAFEHSDVKYYDVSAYTVDFMYQFPEVDEAVFIKSSTN
NTTDIDKSFDLPIPDIAADKLLDILISDSGHYDLSQSASLDYMAVGLNALSAGEDILNWT
VIAPASGQVPQIENIDISNFISDSALESATDEIELTAITKSLSGIDGYQDYLSSRASLPI
LEFTKEKAKASESAFLSITLNNASLQGLSNLPNSSQKIKAYAANKFLITANN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttaaaactatctcattaatttcaatttgcagcttaataaccgcctgcggaggt
ggaggaagctcaagtactacaccagataacagtaactcaggcaccaacacatcaaatact
ttatcattggttgccaaatataaagatgcctgtggaaatgaagtgctagcaagcgatgcc
gcactattgattcataacgaagattactcaaacaaagaaattatcactgcagatcaaaat
ggtaaattaacctaccaatcaaccaactcaacgcaaacaatttcaattgttatgcctgga
caaaataaagtaggtaatattacccctatcaatatagcgacttttattgattaccctatc
aaggatatgggcgagttcattgactatacatatgaaactgatgcctgttcatgtcaaaca
tttaatttacaagttagtactcccgcgagagcaaacgatattggacagggaaaaatattt
ggcatcgaaggcgccgcaaatatatcaagctatagggggcaaaatcatttcgataacttt
atggtttgcaaaaagcaatctggagactggcctctagtttcaacgataatcaatttcgat
tcacccagtgaatcctttgctgcctatattcctgatattgcaaataccactgtaattaat
gctgaaaatcagggaaagattgttgatattagcactaatgattacagtgctaataaacga
gttacaactgtaataaatgagttaaattcattaagaagttatacctttgactcatcgcaa
aatgtctatgcttttgagcacagcgatgtaaaatattacgatgtttcagcctacacggta
gactttatgtaccaattccctgaggtagatgaagcagtttttataaaatcatcaacaaac
aacactacagatatcgataagtcatttgatcttcctataccagatattgctgccgacaag
ttactcgatattcttattagtgactcaggtcattatgatctttctcaatcagcctcgtta
gattacatggcagtaggtctaaatgcattaagcgctggtgaagatatattaaattggacc
gtaatcgcgccagcatcaggtcaagtacctcaaatcgaaaatatcgatatttccaacttt
atttccgattcagcactagaatcagctaccgatgaaattgaattaacagcaatcactaaa
agtttaagtggtatagatggctatcaagactatcttagcagtagagcatctttaccaata
ttagaatttacaaaagaaaaggctaaggcgtcagagtccgcttttctcagtatcacgctt
aataacgcaagtttgcaaggattaagtaacctacccaatagttcgcaaaaaattaaagca
tatgctgcaaataaattcttaattactgcaaataactaa

DBGET integrated database retrieval system