KEGG   Litorilituus sediminis: EMK97_12335Help
Entry
EMK97_12335       CDS       T05852                                 

Definition
(GenBank) DUF3754 domain-containing protein
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3754 SPC12 DUF5343
Motif
Other DBs
NCBI-ProteinID: QBG37817
UniProt: A0A4P6PDL2
Position
complement(2775156..2776346)
Genome map
AA seq 396 aa AA seqDB search
MCAQELNGTVCDKSFQQFCQLLASVIHHDYHDLLESLKNDYAPFDPNADTRQLTAITETE
KAKRQKGFANNFAKVLNAANFEQITEQDLQDALHEESLFKVRLEVEFDDFEQVVFYRRGE
STKSETLRSFWGLRKQTINFTNYDRVAVFITFKDKQHFANKNKLPLGFEPGATIVKLFQN
VPKADLEMLFPNSEVRMRPIDKIIIGGSALVGGIVVLVTKLGASILLLAALLAFWLGWRQ
ETVEMTQQHFISFAIGMGVFGSFIFKEWSKFKNRKIKFMKALSDNLYFKNLDNNAGVFHT
LIDSAEEEDFKEALLAYSFLLKNPEGLSAEELDKQVEAWFASQYQCHLDFEISDALDKLT
KMKLVKQTEQGYQAVSLAKAKQTLDCYWDNIFTYNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcgcaagaactaaacggcacagtttgtgataaatccttccagcaattttgtcag
ctattagccagcgttattcatcacgattatcatgatttacttgaatcgttaaaaaacgat
tacgcgccatttgaccccaacgcagataccagacagttaacagcaatcacagaaactgag
aaagcgaaacgacaaaaaggctttgccaataattttgccaaagtgctaaacgccgctaat
tttgagcaaattaccgaacaagatttacaagatgccctgcatgaagagtcactctttaaa
gtgcgcttggaagtagagtttgatgactttgagcaagtggtgttttatcgtcgcggtgaa
tcgacaaaatcagaaacactgcgctcattttgggggttaagaaagcaaaccattaacttc
actaattatgatcgcgttgcagtatttatcactttcaaagataaacagcactttgccaat
aaaaacaaactaccacttggctttgagccaggcgcaaccatagtaaaactatttcaaaac
gtgccgaaagcagatttagaaatgctctttcccaacagtgaagtacgcatgcgcccgata
gataaaattattatcggtggctctgcacttgttggcggcatcgtggtattagtcactaaa
ttaggcgcatcgatattactgctggcagctttactggctttttggcttggctggcgacaa
gaaaccgttgaaatgacccagcagcactttatttcttttgccattggcatgggggtattt
ggcagctttattttcaaagaatggagcaagtttaaaaaccgaaaaattaaatttatgaag
gctctttccgataacctgtactttaaaaatttagataacaatgccggcgtttttcatacc
ctgatagattctgccgaagaggaagattttaaagaagcgctattagcttacagcttttta
ttaaaaaatcctgaaggtttaagcgctgaagaactcgataagcaagttgaagcttggttt
gctagccaataccaatgccatttagattttgaaatatcagacgcgctagataaattaact
aaaatgaagttagttaagcaaactgagcaaggttatcaggcggtttcgcttgcaaaagcc
aaacaaacattagattgctactgggataacattttcacttataattcataa

DBGET integrated database retrieval system