KEGG   Litorilituus sediminis: EMK97_12505Help
Entry
EMK97_12505       CDS       T05852                                 

Definition
(GenBank) efflux RND transporter periplasmic adaptor subunit
  KO
K15727  membrane fusion protein, heavy metal efflux system
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsd02000]
    EMK97_12505
Transporters [BR:lsd02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   EMK97_12505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 PYNP_C Methyltrn_RNA_3 CobS_N
Motif
Other DBs
NCBI-ProteinID: QBG36481
UniProt: A0A4P6P4K8
Position
2813025..2814245
Genome map
AA seq 406 aa AA seqDB search
MNNIFQITGIALVIIFAVFSINTTSASDSQHNTSHDEHLHDVAKPIKAVGHDHADKGNNP
EKRSAAQEEHEQGVSLSQEKIKLAGIKVNAVFAKKHINTVYAPGEVKANGYKSYLVSPRT
DSVVINRHASLGEHVKTGQKLVTLFSETMAQTQADFLIASSNWQRANKLGRNNISERTLV
EAENIYKGVYGKLVAFGLTTQAIEKISQQDSSTFGQYALVAEREGVVLQDDFMQGQRIEA
GETIMLLADETDLWVEASIPANKELNLVFGSPALIDLNGVKYQAKVIQEAHTIDPITRTR
TVRLSVTNNGHKLHSGMFVKVYFQFESSSDVIAVPEEALIRSSDGDWTVFIEEQPNKFKA
IEVTTGQAFSEYRQVFGVESGMKVVTRGAFFVASEIAKGGFDPHNH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttttcaaatcacaggcatagccttagtgattatttttgctgtgttttcg
ataaacacaacatcggctagtgatagccaacataacacaagccacgatgaacatttgcat
gacgttgcaaagcccattaaagcagtaggccatgatcatgctgataaaggcaataatcct
gagaaacgttcagcagcacaagaagagcatgaacaaggcgtttctttaagtcaggaaaaa
attaaattagcaggcattaaagttaatgccgtgtttgcaaagaaacacatcaatacggtt
tatgctccaggcgaagttaaagccaatggctataagagttaccttgtttcgccccgtaca
gactctgtggttattaatcgccatgccagcttaggtgaacatgtaaaaactgggcaaaag
ttggttaccttgtttagtgaaactatggcgcaaacacaagctgactttttgattgcatca
tctaactggcagcgagcgaacaagctaggtcgtaataacataagtgaacgcacgcttgtt
gaagctgaaaacatttataaaggtgtctatggtaagttggttgcttttggtttaactaca
caggcgattgaaaagatatcccagcaagatagctctacctttggacaatacgcgcttgtt
gctgagcgagaaggtgttgttttgcaagatgactttatgcaggggcaacgtattgaggca
ggtgaaacgattatgctgcttgctgatgagaccgatctttgggtagaagccagtattccg
gcaaataaagaattaaatttagtctttggcagtcctgccctaattgatttaaatggtgtc
aaataccaagccaaggtcatacaagaagctcacacaattgaccccattactcgaaccaga
acagtaaggctgtcggttactaacaatggacataaacttcattcaggtatgtttgtgaag
gtctattttcagttcgagtcaagcagtgacgtcatcgctgtaccagaagaagcactgata
aggagtagcgatggcgactggacagtgtttattgaagaacagccaaataaattcaaagcg
attgaagtgacaacaggccaagcctttagcgaatatagacaagtattcggcgttgaatct
ggtatgaaagtcgttacccgtggtgcattttttgtcgcctctgagatagctaagggcgga
tttgatccgcacaatcattaa

DBGET integrated database retrieval system