KEGG   Litorilituus sediminis: EMK97_15420Help
Entry
EMK97_15420       CDS       T05852                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_2
Motif
Other DBs
NCBI-ProteinID: QBG37012
UniProt: A0A4P6PBE9
Position
3474787..3475560
Genome map
AA seq 257 aa AA seqDB search
MRFTIKKCVAWGGGLTTAQDWQAFAQHEQSLSQTQELPALKQMPAMQRRRLSPFAKLSLH
CALEAADDCLTTVPSVFASRHGDLAKTSKLISDVASKEVLSPTQFGLSVHNAVGGLFSIY
TGNKAPMSAVSAGEDTFFTALLDALCKLNSNDYKQILLVFTETKVPEIYQQYIQQDELDI
ACALLIESEQESHHQSQQTVFELAIEEKIPQENSAEANESARMQVLDFLAFYYSDNLQTL
VESKRHLWRLARIADQK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgagatttaccattaaaaagtgtgttgcttggggtggtggtcttaccacagcgcaagac
tggcaagcctttgctcaacacgagcaatctttatcgcaaacacaagaattaccggcatta
aagcaaatgccagcgatgcaacgtagacgtttaagcccgtttgccaagttgtcgctacat
tgtgcgcttgaggctgctgatgattgtttaacgacagtgccgagtgtttttgcctctcgc
catggcgatttagcaaaaacgagtaaacttatcagtgatgtcgcaagcaaagaagtgctt
tcgccgacccagtttggtttatctgtacataatgccgttggtggcttatttagtatttat
actggtaataaggcgccaatgtcggcagtgtctgcgggtgaagatacttttttcactgcg
cttttagatgcactttgtaaattaaacagcaatgattataaacaaattttattggtgttt
actgaaacaaaagtaccagagatatatcagcaatatatacagcaagatgagttagatatt
gcctgtgcgctattaattgaaagtgagcaggaaagtcatcaccagtcacaacagacagtg
tttgaactagctattgaagaaaaaataccgcaggaaaatagtgctgaagctaatgaaagc
gcacgcatgcaagtgcttgacttcttagccttttattacagcgataacctgcaaacgttg
gttgaatctaaacgtcatttatggcgtctagctagaatagctgaccagaagtaa

DBGET integrated database retrieval system