KEGG   Litorilituus sediminis: EMK97_15570Help
Entry
EMK97_15570       CDS       T05852                                 

Definition
(GenBank) dihydrofolate reductase
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C DHFR_1
Motif
Other DBs
NCBI-ProteinID: QBG37041
UniProt: A0A4P6P632
Position
3504059..3504592
Genome map
AA seq 177 aa AA seqDB search
MANIVYIATSLDGYIADENNAVDWLHEVDNPGNSDLGFSEHMARVDALIMGRNTFELVAS
FAGDWPYSKPVFVLSHSLEQLPADYQDKASLLQGDIKDIVTNLNHAGFKNLYIDGGVTIQ
NFLKADLIDEMVITTIPVLLGGGIPLFSRLTNKLKFSCVKSELLLNSLVKSTFVRER
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatagtttatatcgccaccagtttagatggttatattgccgatgaaaataat
gctgttgattggctgcatgaagttgataacccaggtaattcagatttaggttttagcgaa
catatggcaagagtcgatgcgctgattatggggagaaatacctttgagttagttgcatct
tttgctggcgattggccttatagtaaacctgtttttgttttatctcattccctagagcaa
cttccagcggactatcaagataaagcgagcttactacaaggtgatattaaagatattgtc
actaatttaaatcatgcgggttttaaaaacttatacatagatggcggtgtcaccatacaa
aattttctcaaagcagatttaattgatgaaatggttatcaccaccattccagtattatta
ggcggtggaattccgctattttctcgtttaactaacaagctaaaatttagctgtgttaag
tcagagctgctgttaaatagcttagtaaaaagtacttttgttcgagaacgttaa

DBGET integrated database retrieval system