KEGG   Litorilituus sediminis: EMK97_16620Help
Entry
EMK97_16620       CDS       T05852                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00260  Glycine, serine and threonine metabolism
lsd00630  Glyoxylate and dicarboxylate metabolism
lsd00670  One carbon pool by folate
lsd01100  Metabolic pathways
lsd01110  Biosynthesis of secondary metabolites
lsd01130  Biosynthesis of antibiotics
lsd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EMK97_16620 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EMK97_16620 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EMK97_16620 (gcvT)
Enzymes [BR:lsd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     EMK97_16620 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD SoxG
Motif
Other DBs
NCBI-ProteinID: QBG37240
UniProt: A0A4V0ZGG7
Position
3747735..3748823
Genome map
AA seq 362 aa AA seqDB search
MTNKTVLHAKHLEAGAKMVDFYGWDMPINYGSQIEEHHAVRTDAGMFDVSHMTIVDVQGS
DAKAFLRRLVINDVEKLATPGKALYTGMCNEEGGVIDDLIIYFFTETDYRLVVNSATREK
DLAWMSKQSEGFDITITERPEFGMLAVQGPQAKAKVATLLTDAEKEAVADMKPFYGVQVG
DLFIATTGYTGEDGYEIIVPDSAAEDFWQKLLDAGVRPCGLGARDTLRLEAGMNLYGLDM
DESVSPLAANMAWTISWEPEERNFIGREVLAAQRAAGDQPKLVGLVLEEKGVLRSHQRVV
TEFGDGEITSGTFSPTLEHSVALARVPRSVKVGDTVEVEMRKKLVKVTVTKPSFVRNGKK
VF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactaataaaaccgtactacatgcaaaacacttagaagctggcgccaaaatggttgat
ttttacggctgggatatgccaattaactatggctcacaaattgaagagcaccatgcggta
cgtaccgatgctggtatgttcgacgtttcacatatgactattgttgatgtgcaaggtagc
gatgccaaagcatttttacgtcgtttagtgatcaacgatgtagaaaagttagccacacca
ggtaaagcactttacacaggtatgtgtaatgaagaaggtggtgtaattgacgatctgatc
atttatttcttcactgaaactgactaccgcttagtggttaactcagcaacgcgtgaaaaa
gatttagcttggatgtctaagcagtctgaaggttttgatatcactattactgagcgtcct
gagtttggtatgttagcggtgcaaggcccacaagcaaaagctaaggttgccaccttatta
acggatgcagaaaaagaagcggtagcagatatgaagccattctacggtgtacaagttggc
gacttatttatcgcaacaacaggttacacaggtgaagacggttacgaaattatcgtacca
gatagcgcagcagaagatttctggcaaaaattgttagacgcaggtgtacgcccttgtggt
ttaggtgctcgtgatactttacgtttagaagcgggtatgaacctttacggtttagatatg
gatgaaagcgtatcaccacttgctgcgaacatggcttggactattagctgggagccagaa
gaacgtaattttattggtcgtgaagtattagctgcacaacgtgctgctggcgatcaacct
aagctggttggtttagtacttgaagagaaaggcgtattacgttcacaccaacgtgtggta
acagaatttggtgatggtgaaatcacctcaggtactttctcgccaacattagaacacagt
gttgctttagctcgtgtaccacgtagcgtaaaagtgggtgacacagtagaagtagaaatg
cgtaagaaattagttaaggttacggtaactaaacctagctttgttcgtaacggtaaaaaa
gtattttaa

DBGET integrated database retrieval system