KEGG   Litorilituus sediminis: EMK97_17335Help
Entry
EMK97_17335       CDS       T05852                                 

Gene name
yeiP
Definition
(GenBank) elongation factor P-like protein YeiP
  KO
K02356  elongation factor P
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lsd03012]
    EMK97_17335 (yeiP)
Translation factors [BR:lsd03012]
 Prokaryotic type
  Elongation factors
   EMK97_17335 (yeiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Elong-fact-P_C EFP_N EFP
Motif
Other DBs
NCBI-ProteinID: QBG37374
UniProt: A0A4P6P771
Position
3917650..3918222
Genome map
AA seq 190 aa AA seqDB search
MPKASEIKKNAAIEHNGKVLIVRDITRSVPQGRAGGSLYRMRLYDVVTGGKVDETFKAED
MLNLADLSRRPAMFSYLDGDEYVFMDNEDYTPYNLNKESISEEVLYINEDTEGLSVIIVD
GNPVGIDLPASVELVITETDPSIKGASASARTKPATLSTGLVVQVPEHISTGDKIKVNTA
EQKFMGRADK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggcaagtgaaataaagaaaaatgcagccatagaacataatggtaaagtgctt
attgttagagatattactcgctcagtacctcaaggtagagcaggtggtagcctataccgt
atgcgtttatacgatgtggttacaggtggtaaagttgatgaaacatttaaagcagaagat
atgctaaacctagctgacttgagccgcagacctgcgatgttctcgtacctagatggcgat
gagtatgttttcatggataacgaagactataccccgtataacttgaataaagaatctatc
agtgaagaagtactttatattaatgaagacacggaaggcctttcagtcatcatagttgat
ggcaacccagtaggtattgatttaccggctagcgttgaattagtgatcactgaaactgat
ccgtcaataaaaggcgcttcagcaagtgcgcgcacaaagcctgcaacgttatcaacaggt
ttggttgttcaagtacctgagcacatctctactggtgataaaattaaagtgaacaccgct
gagcagaagtttatgggacgtgctgataagtaa

DBGET integrated database retrieval system