KEGG   Litorilituus sediminis: EMK97_17690Help
Entry
EMK97_17690       CDS       T05852                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K19226  cationic peptide transport system substrate-binding protein
Organism
lsd  Litorilituus sediminis
Pathway
lsd01503  Cationic antimicrobial peptide (CAMP) resistance
lsd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EMK97_17690
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EMK97_17690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsd02000]
    EMK97_17690
Transporters [BR:lsd02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    EMK97_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: QBG37437
UniProt: A0A4P6PCN3
Position
complement(3989375..3991057)
Genome map
AA seq 560 aa AA seqDB search
MNFNLSKHTKAWLQLYFAFLAIFMLAACSDQNTQSVSQRSIIYCSEGSPETFNPQLVTSG
TTIDATSHQLYDRLITYQGADNTIVPALAKSWHVTRDGKKITFYLRKDVSFHATDYFTPS
RKLNADDVIFSFNRILDANHPFHNISGGIYPFFQSVEFENLVDSIEKINDYTVRFQLNRA
DSSFLANLATDFAIILSAEYAQELIERNTMHDIDTHPIGTGPFKLKEYRVGSLIRYYRHE
NYWQENAQIEQLVYDISPSKTSRLTKLLAKECDVSSYPIAHKKIIERPDLTLDAVTALNI
GYYGFNTKKPPFDSKLVRLAVSLAINKQALVDTVYQGEADTAHSILPQTSWAYDKNIPHH
EYNPNQARALLEVAGYAQGFTMDLWAMPVQRAYNPNAVTMAKLIQADLKKVGIKVNIVSY
EWSTFLRRLAQGEHQSFLLGWSADHPDPDNFFTPMLSCSATETGNNRTFWCNQAYDDLIE
KALKTANVADRKSYYAQAMKILHDEKPLLPIAHSKRYQARGVNVKGNILANFGGISFYHV
FKQAPSEATTSAATQLEEQQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaatctaagtaaacatacaaaagcttggctgcagctatattttgccttccta
gcaatttttatgctcgccgcctgtagtgatcaaaacacacagtcggtaagccagcgcagt
atcatttattgctctgaaggctcaccagaaacctttaaccctcagcttgttacatcaggt
actacgattgatgcgacctcacaccagctctatgaccgacttattacctatcaaggagca
gacaataccattgtccctgcacttgccaaatcttggcatgtaacacgcgatggtaaaaag
attaccttttatttaagaaaagatgtgagttttcatgcaactgactattttacccctagc
cgtaagctaaacgctgacgatgttattttcagctttaaccgtattttagatgccaatcac
ccttttcataacatctctggcggcatttaccctttctttcaaagtgtcgaatttgaaaac
cttgtcgatagcatagaaaaaataaatgattacaccgtacgatttcagctaaatcgcgct
gatagctcattcttagcgaatttagccacagactttgccattatcctctctgctgaatat
gcgcaagaactaatcgaacgcaataccatgcatgatatagatacccacccaattggcaca
gggccgtttaagttaaaagaatatcgagtaggctcactgattcgctattatcgtcatgaa
aactactggcaagaaaatgctcaaattgaacaattggtttacgatatatcaccaagtaaa
acgagccggcttacaaaacttttggcaaaagagtgtgatgttagcagctaccctatcgcc
cataaaaaaattattgagcgacctgatttaacgcttgatgcagttaccgcattaaacatt
ggttactatggttttaatactaaaaagccgccatttgacagtaaactagtacggttagcg
gtcagtttagcgataaacaaacaagcgcttgttgataccgtttatcaaggtgaggctgac
actgctcactctatattaccgcaaacctcttgggcctatgacaagaatatcccgcatcat
gaatataaccctaatcaggctagagccttgttagaggtggctggctacgctcaaggtttt
accatggatttatgggctatgcctgtgcaacgagcctataaccctaacgcggtaactatg
gccaagcttatccaagcagatttaaagaaagttggcattaaagtgaatattgtcagttat
gaatggagcacctttttacgcaggctagcgcaaggagaacatcaaagctttttattaggc
tggtcagcagatcatcctgatcctgataatttcttcacacctatgctgagctgctcagcc
acagaaacaggtaataatagaaccttctggtgtaatcaagcatacgatgacttgattgaa
aaagcgctgaaaacggcaaacgttgctgatagaaaaagctactacgctcaagcgatgaaa
atattacacgatgaaaaacctttactgcctattgctcactctaaacgataccaagcacgc
ggtgttaatgtaaaaggcaacatattagctaattttggcggtatcagcttttatcatgta
tttaagcaagcaccgtcagaagcaaccacttcagctgctacgcaattagaggagcagcaa
taa

DBGET integrated database retrieval system