KEGG   Litorilituus sediminis: EMK97_18210Help
Entry
EMK97_18210       CDS       T05852                                 

Definition
(GenBank) hypothetical protein
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF456 DUF2207
Motif
Other DBs
NCBI-ProteinID: QBG37531
UniProt: A0A4P6P798
Position
4112872..4113198
Genome map
AA seq 108 aa AA seqDB search
MFAKTIIILTIAIFFIAYLMPVANKSDSKPSKKETWQCFFIGLVGAALITPAFYNLVIIP
VGIWFLLFAGGLVPWWSKYKKAFAYQWGIFFGITIGLAAIFEYLQGGI
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaaaccattataattctgacaattgctattttctttattgcttacttaatg
cctgtagcaaataagtcagattcaaagccttctaaaaaagaaacgtggcaatgttttttc
attgggctagtcggtgcagcattaattacaccagcattttacaatttagtcattattccc
gttggaatttggtttttgctatttgcaggaggtttagttccttggtggtcaaaatacaaa
aaagcgtttgcctatcaatggggaatattttttggtattactattgggttagctgcgata
tttgaatatttgcaaggcggcatataa

DBGET integrated database retrieval system