KEGG   Litorilituus sediminis: EMK97_18335Help
Entry
EMK97_18335       CDS       T05852                                 

Gene name
pip
Definition
(GenBank) prolyl aminopeptidase
  KO
K01259  proline iminopeptidase [EC:3.4.11.5]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00330  Arginine and proline metabolism
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EMK97_18335 (pip)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lsd01002]
    EMK97_18335 (pip)
Enzymes [BR:lsd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.5  prolyl aminopeptidase
     EMK97_18335 (pip)
Peptidases and inhibitors [BR:lsd01002]
 Serine peptidases
  Family S33
   EMK97_18335 (pip)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_4 Ndr
Motif
Other DBs
NCBI-ProteinID: QBG37553
UniProt: A0A4P6P7J5
Position
complement(4136327..4137271)
Genome map
AA seq 314 aa AA seqDB search
MNEFYPEIEPYNHFLLSVDQQHEIYVEECGNPNGQAILFIHGGPGGGCSTNDRRFFDPEK
YRIVLFDQRGCGRSLPHGCLENNETKLLVEDIEKIRTKLNIDTWHVFGGSWGSTLSLVYA
QTHPSRVEGLILRGIFLGRPEDTNWAFSGGGATRIFPDFWQEYLNELPEGTGQANVKAAY
DIMTGDDKALALKVAKAWSIWEIRCCTLIPNQDFVDAATGDEAAWTLARHEAHFMINDCF
LSDNQILANCDKIKDIPTTIVHGRYDIVCPFDNAFLLHKALPNSKLIVSEASGHASIEPN
TKHHLIAATKAAIK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattttatcctgaaatagagccgtacaatcactttttactcagtgttgatcag
cagcacgaaatttatgttgaagaatgcggtaaccctaacggccaagctatcttgtttatc
cacggtggtcctggtggcggctgttcaactaacgacagacgctttttcgatcctgaaaaa
taccgtatcgttttatttgatcagcgaggttgtggccgttcactacctcatggctgttta
gaaaataatgaaactaaattgttagttgaagatatagaaaaaatccgcacgaaattgaat
atcgacacttggcatgtatttggtggctcttggggttcaaccttatcccttgtttatgca
caaacacaccctagccgtgttgaaggcttaatcttacgtggcatctttttaggtcgccct
gaagatactaactgggcattttctggcggtggtgcaacgcgcattttccctgatttctgg
caagaatacttaaatgaactaccagaaggtacagggcaagctaacgttaaagcagcctat
gacattatgacaggtgatgataaagcgctcgccttgaaagttgctaaagcctggagtatt
tgggaaattcgttgttgtaccttaataccgaatcaagactttgtcgatgccgcaacgggt
gatgaagccgcatggacattagcgcgtcatgaagcgcactttatgatcaatgactgtttc
ttatctgataatcaaattctcgcaaattgcgataagattaaagatattccaaccaccata
gttcatggtagatacgatatcgtgtgcccatttgataatgctttcttgctacataaggcg
ctgccaaactctaaattaatcgttagtgaagcatcaggtcacgcatcgattgagccaaac
actaagcatcacttaattgccgcaaccaaagctgcaatcaagtaa

DBGET integrated database retrieval system