KEGG   Litorilituus sediminis: EMK97_18455Help
Entry
EMK97_18455       CDS       T05852                                 

Gene name
ychF
Definition
(GenBank) redox-regulated ATPase YchF
  KO
K06942  ribosome-binding ATPase
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lsd03009]
    EMK97_18455 (ychF)
Ribosome biogenesis [BR:lsd03009]
 Prokaryotic type
  Other maturation factors
   EMK97_18455 (ychF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS AAA_18
Motif
Other DBs
NCBI-ProteinID: QBG37568
UniProt: A0A4P6P8U1
Position
complement(4158744..4159835)
Genome map
AA seq 363 aa AA seqDB search
MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPVPDPRLDKLADIVNP
ERVIPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENDNIIHVANKIS
PADDIDVINTELALADMDTAERAIVRQTKRAKGGDKDAKFELPVLEKILKHVEDGQMIRS
LELSKEELAAVKYLNFLTVKPTMYIANVNDDGFEDNPYLDIVRDIAEKEGAVVVAVCAEI
EGELSEMDEDDRIEFMAEMGLEEPGLNRVINSGYGLLSLQTYFTAGVKEVRAWTVKQNAT
APQAAGVIHTDFEKGFIRAEVVSYDDFIEFNGEAGAKEAGKWRLEGKDYPVKDGDVVHFR
FNV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaaatgtggcatcgttggcttaccaaatgtaggtaaatctactttatttaat
gcgctaaccaaagcaggtattgaagctgcaaacttccctttttgtactattgaaccgaac
acaggtgtagtaccagtacctgatccgcgtcttgataaattagcagatatcgtcaaccct
gaacgcgttattccaaccaccatggaatttgttgatattgccggtctggttgcaggcgca
tcaaaaggtgaaggtttaggtaataaattcttagcaaacattcgtgaaactgacgccata
ggtcatgtagtgcgttgttttgaaaatgacaacattattcacgttgccaacaaaatcagc
ccagcggacgatattgatgttatcaatacagaattagcccttgctgatatggataccgct
gaacgtgctattgtacgtcaaacaaaacgcgctaaaggtggcgataaagacgctaagttt
gaactacctgtactggaaaaaatacttaagcatgttgaagacgggcaaatgatccgctct
cttgagttaagtaaagaagagttagccgcggtaaaatacttaaacttcttaaccgtaaaa
ccaaccatgtacattgctaatgtcaatgacgatggttttgaagataacccttatttagat
atcgttcgtgatattgctgaaaaagaaggtgcggttgtggttgccgtatgtgccgagata
gaaggcgaattatctgaaatggatgaagatgatcgtattgagtttatggctgaaatgggc
ttagaagagccaggcttaaaccgcgtgatcaactcaggttatggcttattaagtttacaa
acctactttactgccggtgttaaagaagttcgtgcatggacagtaaaacaaaatgccact
gcacctcaggctgctggcgttattcatactgattttgaaaaaggctttattcgcgctgaa
gtggttagttatgatgactttattgagtttaacggtgaagcaggtgctaaagaagccgga
aaatggcgcttagaagggaaagactaccctgttaaagatggcgatgttgttcactttaga
tttaatgtttaa

DBGET integrated database retrieval system