KEGG   Listeria seeligeri: lse_0730Help
Entry
lse_0730          CDS       T01184                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lsg  Listeria seeligeri
Pathway
lsg00010  Glycolysis / Gluconeogenesis
lsg00030  Pentose phosphate pathway
lsg00051  Fructose and mannose metabolism
lsg00680  Methane metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_0730 (fbp)
   00030 Pentose phosphate pathway
    lse_0730 (fbp)
   00051 Fructose and mannose metabolism
    lse_0730 (fbp)
  Energy metabolism
   00680 Methane metabolism
    lse_0730 (fbp)
Enzymes [BR:lsg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     lse_0730 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CBH26881
Position
complement(787266..789227)
Genome map
AA seq 653 aa AA seqDB search
MEEIDMKYLRLLAKQYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGTELDDAEINSLSTLIYYPEEKMDLIAEELEDMHDWYRTTLFRLIEFC
QYVASKYTRSKVRKAMPEDFAYILEELLQENYNEDDKKMYYEEIIQHIISLDRAEEFISA
LSRLIQQLVVDHLHIVGDVYDRGPYPDKIIDTLMNYHSVDFQWGNHDILWMGAASGSKVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEIYHDDPCTYFQPKNEDGAEYSNAEIT
QIARMHKAIAIIQFKLEGEIIARHKEFKMEHRLLLNFIDYQTGTIRLKGQKYDLLDTNFP
TIDPANPYQLTSAEKELIEKITAAFKNCRRLQKHVQFLYAKGSMFLTYNGNLLYHGCIPL
HEDGSFMAMELRNKNYSGQALLEQFEILTREAYVRPAGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFIADKATHTEEKNPYYKLRNEEVICQQILEEFGLDADCGHIINGHTPV
KENKGESPIKADGKMLVIDGGFAKAYHKKQDLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVKDTDIGKQLNTQAEDLKKLLTAYRNGLLHESH
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcgacatgaaatatttgcgtttactggctaaacaatatcctactatcgct
aaaacagccacagaaatcatcaatctagaagctattatgaatttaccaaaaggaacggag
cattttttaagtgatgttcacggggaatacagtgcttttgaacaagttttacgcaatggt
tccggtgttgttaaacggaaaattcgtgatatttttggtacagaactagatgatgcggaa
atcaattcacttagcacgctgatttattaccctgaagaaaaaatggatttaatcgctgaa
gaacttgaagatatgcacgattggtaccgtacgacactttttcgcttaattgaattttgt
cagtatgttgcttctaaatatacgcgttccaaagtacgaaaagcgatgccagaagatttt
gcttacatattagaagagttattacaggaaaattataatgaagatgataaaaaaatgtat
tatgaagaaattattcaacatatcatttcattagaccgcgcagaagaatttataagtgcc
ctttcacgtctaattcagcaacttgtagtggatcatttgcatattgttggggatgtgtat
gatcgtggtccttatcctgataaaattatagacacgctaatgaactatcattcggttgat
ttccagtgggggaaccacgatattttatggatgggcgctgcaagtggttcgaaagtttgt
gcggctaatgttatccgaatttccgctcgttacttgaatttagatattttggaagatagt
tatggtatttcgctccgcccacttgctctttttgccgatgaaatttaccacgacgatcct
tgcacctatttccaacctaaaaatgaggatggggcagagtatagcaatgctgaaatcaca
caaattgcgcggatgcataaagctatcgcaattattcaatttaaattagaaggagaaatt
atcgctaggcacaaagaatttaaaatggagcatcgcctgctactaaattttattgattat
caaaccggtaccatccgcttaaaaggacaaaaatacgacttactcgacacaaacttccca
actatcgaccctgcaaatccatatcaactaacgtctgccgaaaaagagcttatcgagaaa
attactgctgcgtttaaaaattgtcgtcggttgcaaaaacacgtccaatttttatatgca
aaagggagtatgtttttaacttacaacggtaatttgctttatcacggttgtatcccgcta
catgaggatggttcatttatggcgatggaattacgcaataaaaactattctggtcaggcg
cttttagaacaatttgagattctaactagagaggcttacgtccgccctgctggtacaaaa
gaaaagaaatatgcttgtgatatcgtttggtatttgtggactggcgccatatcttcttta
tttggaaaaagtgaaatgactaccttcgagcgctattttattgcagacaaagccactcat
accgaagaaaaaaatccttactataaattacgtaatgaggaagttatttgtcagcagatt
ttagaagagtttgggcttgatgctgattgtgggcatattataaacggacacactccagta
aaagaaaataaaggagaaagtccaattaaagcagatggaaaaatgcttgttattgatggc
ggatttgcgaaggcgtatcacaaaaagcaagacttagctggctatacgttgctttttaat
agttacggattacaattagtcagccaccaaccctttacaacaaaagaagacgccattaaa
aacgaaactgatattctatctacaaggcaagttatcgaaatggaaattaatcgtaagcga
gtgaaagacaccgacattggaaaacaactgaatacccaagccgaggatttaaaaaaactt
ctcacagcgtatcgcaacgggttacttcatgaaagtcattga

DBGET integrated database retrieval system