KEGG   Listeria seeligeri: lse_1264Help
Entry
lse_1264          CDS       T01184                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lsg  Listeria seeligeri
Pathway
lsg00260  Glycine, serine and threonine metabolism
lsg00630  Glyoxylate and dicarboxylate metabolism
lsg00670  One carbon pool by folate
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    lse_1264 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lse_1264 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    lse_1264 (gcvT)
Enzymes [BR:lsg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     lse_1264 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: CBH27415
Position
1282252..1283340
Genome map
AA seq 362 aa AA seqDB search
MTELQKTPIHPIYEKYGAKTIDFGGWDLPVQFSGIKAEHEAVRTDVGLFDVSHMGEVLVE
GSDSTAYLQYLLSNDIEKIKIGKAQYNIMCYENGGTVDDLVVYKITETKYILVVNAANTE
KDYEWMVKNVFGNVTVTNVSSMYGQLALQGPNAEKILTKLTDVDLSSISFFGFVEDANVA
GVKTIISRSGYTGEDGFEIYMQSDDAIKVFEAIMAEGVLPIGLGARDTLRLEAVLALYGQ
ELSQDITPLEAGLNFAVKLKKEADFIGKEALVKQKEAGLTRKLVGIELIERGIPRHDYSV
FQNDKKIGIITSGTQSPTLGTNIGLALLETPYTELGQEVEVGIRTKKIKAKVIATPFYKR
AK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattacaaaaaacaccaattcatccaatctatgaaaaatatggagctaaaaca
attgactttggtggatgggatttacctgtacaattttctggaataaaagctgaacatgag
gccgtacgaaccgatgtagggctatttgatgtgtcacacatgggagaagttttggtggaa
ggatctgacagtacggcatatttacaatacttgttatcaaatgacatagaaaaaataaaa
ataggtaaggcacaatataatattatgtgctatgaaaacggtgggacagtagacgatttg
gttgtttataaaataacagaaacaaaatacatactagtcgtaaatgcagccaatacggaa
aaagattatgagtggatggtaaagaatgtttttggaaatgttactgttacgaatgtttcc
tctatgtatggacaattagcgcttcaaggcccaaatgctgaaaaaatacttactaaacta
accgatgttgatttaagttccattagtttttttggatttgttgaagacgcaaacgtagct
ggagtaaaaacaattatttctagaagtggttatactggtgaagatggctttgagatttac
atgcaaagtgacgatgctataaaagtttttgaagctattatggcagagggtgttttacca
attggtttaggtgctcgagatacattgcgtttagaagctgtacttgcgctctatggtcaa
gaattaagtcaagatattacgccgcttgaagcaggcttgaactttgcagtgaagctgaaa
aaagaagcggattttatcggaaaagaagcgttggttaaacaaaaagaagcaggtttaacc
cggaaattagttggaattgaattaattgaacgaggaataccacgccatgattattccgtt
tttcaaaatgataaaaaaatcggtataattacttctggtactcaatcgccaactcttgga
acaaatattggtttagcgttacttgaaacaccgtacacagagctcgggcaagaagtagaa
gtgggtattcgaactaaaaaaataaaagcaaaagttatagcaacaccattttataaacgc
gcaaagtaa

DBGET integrated database retrieval system