KEGG   Listeria seeligeri: lse_1333Help
Entry
lse_1333          CDS       T01184                                 

Definition
(GenBank) unnamed protein product
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lsg  Listeria seeligeri
Pathway
lsg00071  Fatty acid degradation
lsg00072  Synthesis and degradation of ketone bodies
lsg00280  Valine, leucine and isoleucine degradation
lsg00310  Lysine degradation
lsg00362  Benzoate degradation
lsg00380  Tryptophan metabolism
lsg00620  Pyruvate metabolism
lsg00630  Glyoxylate and dicarboxylate metabolism
lsg00640  Propanoate metabolism
lsg00650  Butanoate metabolism
lsg00900  Terpenoid backbone biosynthesis
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
lsg01212  Fatty acid metabolism
lsg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lse_1333
   00630 Glyoxylate and dicarboxylate metabolism
    lse_1333
   00640 Propanoate metabolism
    lse_1333
   00650 Butanoate metabolism
    lse_1333
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lse_1333
   00072 Synthesis and degradation of ketone bodies
    lse_1333
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lse_1333
   00310 Lysine degradation
    lse_1333
   00380 Tryptophan metabolism
    lse_1333
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lse_1333
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lse_1333
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lse_1333
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsg04147]
    lse_1333
Enzymes [BR:lsg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lse_1333
Exosome [BR:lsg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lse_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBH27484
Position
complement(1360062..1361231)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAARTPIGKFGGSLKDVSAVELGATVVKGILKRANIAPEEVDQVIFGNVLQAG
LGQNVARQISIKAGIPYQVPGVTINEVCGSGLKSIMFGRQAIQLGEADIVVVGGTENMSQ
APLLLNPELKDEEFNPKNLKNSMLIDGLTDVFGEYHMGITAENVAEKFAISREEQDAFAH
NSQMKAARAQEKDLFEEEIIPVQLADGSFFHKDETIRANSTLEKLATLKSAFKEGGTVTA
GNSSGINDGASAIILMSKEKALAENIPYLATIKVTSEVGVDPAIMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLEIPEDKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKQTGLASLCIGGGIGIALVIERV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgccgctcgcaccccaattggaaaatttggtggtagt
ttgaaagatgtaagtgcagtagaattaggagcaactgtcgtcaaaggtattttaaaaaga
gctaacattgctccagaagaagtagatcaagtaatttttggtaatgtgctacaagctggt
cttggacaaaatgtggcacgacaaatttcgataaaagcaggaatcccatatcaagttcct
ggtgtaacaatcaatgaagtttgcggttctggactaaaatcaattatgttcggtagacaa
gcaatccaactaggagaagcagatattgttgttgtaggagggactgaaaatatgtcccaa
gcaccgttattacttaatcctgaattaaaagatgaagagtttaatccaaaaaacctaaag
aatagcatgttaattgatggcttaactgatgtatttggcgaataccacatgggaattacc
gctgaaaacgttgcagaaaaatttgctatttctcgtgaagaacaagatgcattcgcacat
aattcgcaaatgaaagcagctagagcccaagaaaaagatctttttgaagaagaaattatt
ccagttcaacttgcagatggcagttttttccacaaagatgaaacaattcgtgctaattcg
actttagaaaagcttgctacactaaaaagcgcttttaaagaaggtggaacggtaacagca
gggaactcatctggtattaacgatggcgcttctgccattattttgatgtctaaagaaaaa
gcattagcagaaaacattccttatttagcgacaattaaggtcacatccgaagtcggtgtt
gatcctgcaattatgggatatgcgccatattacgctgttaatgaagctctaacaaaaggt
ggctactcgattgatgaaatagatttattccatcttaatgaggcgtttgcttctcaatct
gttgccgttgctagagaccttgaaatcccagaagacaaattaaatatctacggaggtgct
attgcgctagggcacccaattggcgcttcaggagctcgtattgttgtatcattattaaat
gaactaaaacacgaaaacaaacaaactggccttgcctcactatgcatcggtggcggaata
ggaattgcgttggttattgagagagtataa

DBGET integrated database retrieval system