KEGG   Listeria seeligeri: lse_2123Help
Entry
lse_2123          CDS       T01184                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II family
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lsg  Listeria seeligeri
Pathway
lsg00010  Glycolysis / Gluconeogenesis
lsg00030  Pentose phosphate pathway
lsg00051  Fructose and mannose metabolism
lsg00680  Methane metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
lsg01230  Biosynthesis of amino acids
Module
lsg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_2123
   00030 Pentose phosphate pathway
    lse_2123
   00051 Fructose and mannose metabolism
    lse_2123
  09102 Energy metabolism
   00680 Methane metabolism
    lse_2123
Enzymes [BR:lsg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     lse_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBH28274
Position
complement(2180693..2181547)
Genome map
AA seq 284 aa AA seqDB search
MYVSMKGMMQRANEGNYAVMAINCFNLETARAVIDAAQELRAPIIIDLLQEHLDTHLGSR
FLTKPIIKMAEEASVEVAINLDHGQDVAIVKQCLADGFSSVMMDASSSPYEENVAITKEM
VKFAEVYNASVEAEVGNIGAVTGDNYTNQAMYTDPKVAIDFAKRTGIDALAISYGSSHGD
YPAGFTPAFQFDIVREIKAATNMPLVLHGGSGCGAENIQKSVQLGINKINVGSDFMKAQT
TKVRDLLQETPAISFVDLIHETIQAGKEAVQYYILLSGSNGKSL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtctcaatgaaaggcatgatgcagcgtgctaatgaaggaaactatgctgtaatg
gcaattaattgctttaatttggaaactgcaagagctgtaattgatgcggctcaggaactt
agagcgccaattattattgatttattgcaagagcatttagatacacatttaggaagtcga
tttttaacgaaaccgattatcaaaatggctgaagaagcaagcgtggaagtagcgattaac
ttagatcacggacaggatgtggcgattgtaaagcaatgtctggcggatggcttttccagt
gtcatgatggatgcatctagttccccgtatgaagaaaacgtcgcgattaccaaagaaatg
gttaagtttgcggaagtctacaatgccagtgtggaggcagaagtaggtaatattggtgca
gttacaggagataattacacaaaccaagcgatgtatactgatcccaaagtcgctattgat
ttcgctaaaagaactggtattgacgcactagctatctcttacggttcatcgcacggcgac
tatccagcaggctttaccccagcatttcaattcgatattgttagggaaatcaaagcagcg
acgaatatgccgctcgtattacacggtggctcaggttgcggcgcagaaaatattcaaaaa
tctgtccaacttggaattaataaaattaacgtgggttcagactttatgaaagctcaaaca
acgaaagtgagagatttgttacaagaaacaccagctattagttttgttgacttaattcat
gaaaccattcaagccggcaaagaagctgttcaatattatattttattatccggttctaat
ggaaaatcactttaa

DBGET integrated database retrieval system