KEGG   Listeria seeligeri: lse_2508Help
Entry
lse_2508          CDS       T01184                                 

Definition
(GenBank) acetamidase/formamidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
lsg  Listeria seeligeri
Pathway
lsg00330  Arginine and proline metabolism
lsg00360  Phenylalanine metabolism
lsg00380  Tryptophan metabolism
lsg00627  Aminobenzoate degradation
lsg00643  Styrene degradation
lsg01100  Metabolic pathways
lsg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    lse_2508
   00360 Phenylalanine metabolism
    lse_2508
   00380 Tryptophan metabolism
    lse_2508
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    lse_2508
   00643 Styrene degradation
    lse_2508
Enzymes [BR:lsg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     lse_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-ProteinID: CBH28659
Position
2584582..2585481
Genome map
AA seq 299 aa AA seqDB search
MKNLVTREQLSYEMDKSTQPALTVKDGSVVKIKIKDHFNGQIHEERLHYGEIDWKQISPT
SGPIYIDAAEPGDLLAITIEKIKITSNDTVLLNGPNIGLLDNLLPTNSIRRYKIQNSKII
YSEHINIRVQKTIGLLKTESITETKPFHKPTNCGGTLDSAYLTEGSTIFLPVEKQGALLH
IGDVHATVGLGKITSSCAEIPAEVTLRLQILKNKKAPTPVIIQNNHLICLASDETIESAA
RTALQNMVDLLTATGKMTIEDAVFLLSLNGDFEVCQLSKPSRIASIKLPLDYFPEMPFL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctagtaaccagagaacagttgagttatgagatggataaatcaacacaacct
gcgcttactgtgaaagatggttccgttgtgaaaataaaaataaaagatcacttcaacggc
caaattcacgaagaacgacttcattacggtgaaatagattggaagcaaatttcacctacc
agcggaccgatatatatagacgcggccgagcctggagatttacttgcaataacgattgaa
aaaattaagattacaagtaacgatactgtcttgctaaacgggccaaatattggattacta
gataacttactgccaactaatagcattcggcgttacaaaattcaaaatagtaaaatcatt
tactcagaacacattaacatccgtgttcaaaagacaattggattattaaaaacagagtct
atcactgaaacaaaaccatttcacaaacccactaattgtggaggaacacttgactcagca
tacctcacagaaggatcaacaattttcttgccagtcgaaaaacaaggagcacttcttcat
attggcgatgttcacgctacagtaggtctaggcaaaatcacatcaagttgcgctgaaatt
ccagccgaagtcactttaagattacaaattttgaaaaataaaaaagctcccacacctgtc
atcattcaaaacaatcacttaatttgtctagcttccgatgaaacaatcgaaagcgccgcg
agaacggctttacaaaacatggtagatttattaaccgctactggtaaaatgacaattgaa
gatgctgtttttctactatcattaaacggagactttgaagtttgccaattaagcaaacca
agccgaattgcaagcataaaattaccacttgattattttccagaaatgccttttttataa

DBGET integrated database retrieval system