KEGG   Legionella sainthelensi: CAB17_10995Help
Entry
CAB17_10995       CDS       T05293                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lsh  Legionella sainthelensi
Pathway
lsh00790  Folate biosynthesis
lsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAB17_10995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsh04147]
    CAB17_10995
Enzymes [BR:lsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CAB17_10995
Exosome [BR:lsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAB17_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUH72528
UniProt: A0A0W0YUP4
Position
complement(997229..997570)
Genome map
AA seq 113 aa AA seqDB search
MTSDLSSKHCESCEGIGTALNAEQIKNLLPQLDKNWAVSSDNRSIKRSLSFKNFYETMAF
VNALAWIANIENHHPDLEIGYNYCHVHFMTHALNGLSHNDFICAAKMDKLLAD
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgacttaagcagcaaacattgtgaatcatgcgaaggcataggtaccgcatta
aatgcagagcaaataaaaaatttattgcctcaattagataagaattgggctgtgagctcg
gataaccgcagcataaaacgcagtttatcctttaaaaatttttatgagactatggctttt
gtcaatgcccttgcctggatagccaatattgaaaatcatcatcctgatttagaaattggt
tataactattgtcatgttcatttcatgacgcatgcactgaatggtttgagtcataatgat
ttcatttgtgctgcaaaaatggataaattattagccgattaa

DBGET integrated database retrieval system