KEGG   Legionella sainthelensi: CAB17_15705Help
Entry
CAB17_15705       CDS       T05293                                 

Definition
(GenBank) outer membrane protein MIP
  KO
K03773  FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC:5.2.1.8]
Organism
lsh  Legionella sainthelensi
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lsh03110]
    CAB17_15705
Enzymes [BR:lsh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CAB17_15705
Chaperones and folding catalysts [BR:lsh03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    CAB17_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_N FKBP_C DUF4402
Motif
Other DBs
NCBI-ProteinID: AUH73337
UniProt: O32838
Position
complement(2047744..2048445)
Genome map
AA seq 233 aa AA seqDB search
MKMKLVTAAIMGLAMSTAMAATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAK
GMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGEAFLSANKSKPG
IVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIP
GWTEALQLMPSGSTWEVYVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaattggtcactgcggccattatgggtttggcaatgtctacagcaatggct
gcaactgatgctacatcgcttactacggacaaagataaattatcttatagtattggtgct
gatttaggaaaaaactttaaaaatcaaggcattgacattaatccagacgtattagctaaa
ggaatgcaagatggaatgtctggtgctcaattgattttgactgaagaacaaatgaaagat
gttctgagtaaatttcagaaagatttgatggctaagcgtagcgctgaatttaataaaaaa
gcagaagaaaacaaagcgaaaggcgaagcgttcttatctgctaataaatcaaagcctgga
atagtagtgttaccaagtggtttgcagtataaaattattgatgctggtactggtgcaaaa
cccggtaaatcagatactgtaactgttgaatatactggtaccttaattgacggtactgta
tttgatagcactgaaaaagcaggtaaaccagctacatttcaagtgtctcaagtaattcct
ggttggacagaagcattacaattaatgccttctggttctacatgggaagtttatgttcct
gcagatttagcttatggcccacgtagtgtaggtggccctataggtccaaatgaaacttta
atcttcaaaattcatttgatttctgtgaaaaaagcagcctaa

DBGET integrated database retrieval system