KEGG   Legionella sainthelensi: CAB17_17015Help
Entry
CAB17_17015       CDS       T05293                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine(1911/1915/1917) synthase RluD
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lsh  Legionella sainthelensi
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lsh03009]
    CAB17_17015 (rluD)
Enzymes [BR:lsh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CAB17_17015 (rluD)
Ribosome biogenesis [BR:lsh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CAB17_17015 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 NepR
Motif
Other DBs
NCBI-ProteinID: AUH73560
UniProt: A0A2H5FPY7
Position
2362743..2363708
Genome map
AA seq 321 aa AA seqDB search
MIEPIQRQLTIPREYHNQRIDSVLAHLLPDYSRSQISNWIKSGTITLNHQSCKPKDKVEG
GDLIEINVDFNKTDTHLDYCAPEEIPINIIFEDEDLLVLNKPANMVVHPGAGNKEHTLVN
ALLHHAPSLTHLPRAGIVHRLDKDTTGLLIVAKTLPAHTSLIRQMQAREIKRHYITLVQG
HIISGGTIDTGFGRHPRNRLKMAVQEHGRQAITHYAVKKQYHDFTLLDVNLMTGRTHQIR
VHLAYIHHPVVGDPLYGTRMRFPAQASEHLRALFQNFKRQALHARTLSFYHPKTEKELTL
MAPIPDDFQLLLDTLDEHYED
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacctattcaaagacaattaaccattcctcgcgagtaccataatcaacgcatt
gatagtgtactcgcacacctacttcctgactattcgcgctcgcaaatcagtaactggatt
aaaagtggcacaataacgcttaaccaccaatcgtgtaaacccaaagataaagttgagggt
ggtgacctaatcgaaattaatgttgattttaataaaacagacactcatttagattattgc
gccccagaagaaattcctataaatattatctttgaggatgaggatcttttagtactcaat
aaaccagcaaatatggttgtacatcctggtgctggaaataaagagcatacattggttaat
gccttattacatcatgcgccctcactcacacatttacctcgagcagggattgttcatcga
ctcgataaagacacaacaggtcttttaattgtagctaaaaccttacccgcacatacctct
ttgatacgccaaatgcaagctcgtgagattaaacgtcattacattactttagtacaaggc
catattatttccggcggcacgattgatacaggttttggacgccaccctagaaatcgactc
aaaatggctgtacaagaacatggaaggcaagccataactcattatgcagttaaaaagcag
tatcatgattttactttattggacgttaacctcatgactggaagaacacaccaaatcaga
gttcatctagcatacatccatcatcctgtcgttggtgatccactttacgggacacgaatg
cgttttccagcgcaagcatctgaacacttacgcgccctatttcaaaactttaaaagacaa
gcactgcacgcacgaacactctcattttatcatcctaaaacagaaaaagagttgacgctt
atggcccctatccccgatgattttcaactccttctagatacattggacgagcattatgaa
gactaa

DBGET integrated database retrieval system