KEGG   Lactobacillus salivarius CECT 5713: HN6_00481Help
Entry
HN6_00481         CDS       T01962                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00072  Synthesis and degradation of ketone bodies
lsi00280  Valine, leucine and isoleucine degradation
lsi00650  Butanoate metabolism
lsi00900  Terpenoid backbone biosynthesis
lsi01100  Metabolic pathways
lsi01110  Biosynthesis of secondary metabolites
lsi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HN6_00481
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HN6_00481
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HN6_00481
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HN6_00481
Enzymes [BR:lsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     HN6_00481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ADJ78762
Position
571963..573126
Genome map
AA seq 387 aa AA seqDB search
MDIGIDKINFFTSNLYVDMTKLAIARNEDPDKYLIGIGQSKMAVIPPTQDIVTMGANAAE
SMLTNEDKESIDLVIVGTESGIDNSKSAAAYIADLLGLRDDIRTFEIKQACYGATAALQM
AKAQIALNPDSKALIIGADIAKYGLNTPGEVTQGGGAVAMLVSANPKLLSFEGGSTYLSR
NIMDFWRPLGHSEALVDGKYSSNVYLDFFNNVYSNYKDKTGFTIDNFEALLFHLPYTKMG
LKALREAQKDADAKVSAKLAHRFEDSRLYNRQVGNLYTGSLYLSLLSLLENNDDLKSGDR
LGLFSYGSGAQGEFFAMLLRKDYRKYLMNTTNEFLQKRTRISVEEYEKIYLRSLHYENNS
ELDLDMDDAQFVLTGIKENQRQYKNRI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatataggaattgataaaattaatttttttacttctaatttatacgtagatatgact
aaactagcaattgccagaaatgaggatccagataaatatcttataggtataggtcaaagt
aaaatggcagtaattccacctactcaagatatagttacgatgggtgcgaatgctgcagaa
tctatgctcacaaatgaagataaagaaagcattgatttggtaattgtggggacagaatca
ggaatagataattctaaatcagcagctgcttatattgctgatttgttaggtctaagagat
gatattagaacttttgaaataaagcaagcatgttatggtgcaacagctgcgttacaaatg
gctaaagcacaaattgcgttaaatccggatagtaaagcgttaattataggtgcagatatt
gctaaatacggattgaatactcctggtgaagtaacacaaggtggtggagcagttgcaatg
ttagttagtgctaatcctaaattattgtcatttgaaggaggttcgacatatctatcacgt
aatataatggacttttggagacctcttggacatagcgaggctttagttgacggaaaatat
tcatcaaacgtatatttagacttttttaataatgtttatagtaattataaagataagact
ggatttactattgataattttgaagctcttttatttcatttgccatatactaaaatggga
ttaaaagcattacgagaagcacaaaaagatgcagatgctaaagtgtcagctaaattagct
catagatttgaagattcacgcttgtacaatcgacaagtaggcaatttgtatacgggttcc
ttatatttaagcctattatcattattagaaaacaatgatgatttaaaatctggtgacaga
ttaggtctatttagttatggttctggagcacagggagaattctttgctatgcttttgaga
aaggattatcgtaaatatttaatgaatacaacaaatgagtttctacaaaaaagaacacgt
atttctgtcgaagagtacgaaaaaatttatttaaggagcttacattatgaaaataatagt
gaattagatttagatatggatgatgctcaatttgttttaacaggcataaaggaaaatcaa
agacaatataaaaatagaatttaa

DBGET integrated database retrieval system