KEGG   Lactobacillus salivarius CECT 5713: HN6_00498Help
Entry
HN6_00498         CDS       T01962                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00010  Glycolysis / Gluconeogenesis
lsi00052  Galactose metabolism
lsi00500  Starch and sucrose metabolism
lsi00520  Amino sugar and nucleotide sugar metabolism
lsi00521  Streptomycin biosynthesis
lsi01100  Metabolic pathways
lsi01110  Biosynthesis of secondary metabolites
lsi01120  Microbial metabolism in diverse environments
lsi01130  Biosynthesis of antibiotics
lsi01200  Carbon metabolism
Module
lsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_00498
   00052 Galactose metabolism
    HN6_00498
   00500 Starch and sucrose metabolism
    HN6_00498
   00520 Amino sugar and nucleotide sugar metabolism
    HN6_00498
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HN6_00498
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HN6_00498
Enzymes [BR:lsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HN6_00498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADJ78779
Position
593527..594489
Genome map
AA seq 320 aa AA seqDB search
MNKKLIGVDLGGTTIKFAILTLDGEIQQKWSVETNILDDGKHIVPDIVESINHHLDLYDM
KPEQFVGIGMGTPGTVDIENGTVEAAFNLNWKEKQNLKEEIEKGTGMKFAVDNDANVAAL
GERWKGAGENDDEVTFVTLGTGVGGGVITNGEMVHGAGAGGEIGHINVQPNGYLCTCGNH
GCLETYASATGVVRVARDMAEEFAGKSDLKKMLDDGQDISSKIVFDLAKDGDVLAERVVD
RVCYYLGFACANIGSLINPSYIVIGGGVSAAGKFLLDQVDSYFKEFAFPSVKKSTTLKLA
ELGNEAGVIGAASLALKFNK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagttaattggtgttgatttaggcggtacaacaattaaatttgctatcttg
acactagatggtgaaattcaacaaaaatggagtgttgaaactaatattttagacgatggt
aaacatattgttcctgatattgttgaatcaattaatcatcatttagatttatatgatatg
aagccagaacaatttgttggaattggaatgggtacaccgggaacagtagatattgaaaat
ggtacagttgaagcagcatttaacttgaactggaaagaaaagcaaaatctaaaagaagaa
attgaaaagggcactggtatgaagtttgctgtagataatgatgccaatgtagcagcattg
ggtgaacgctggaaaggtgccggagaaaatgatgatgaagtaacatttgttacattaggt
acaggtgttggtggtggtgtcatcactaatggtgaaatggttcacggagctggagctggt
ggtgaaattggtcatataaatgtacaaccaaatggctatttgtgtacttgtggaaatcat
ggctgtttagaaacttatgcttctgcaacaggtgttgtacgtgttgcacgtgatatggct
gaagaatttgctggaaaatctgatttaaagaaaatgttagatgatgggcaagatattagt
tctaagatagtatttgatttagcaaaagatggcgatgttttagctgaacgtgttgtggat
cgtgtttgctactatttaggatttgcttgtgctaatattggtagtcttatcaatccatca
tatattgtaattggtggtggcgtttctgcagcgggtaagttcttattagatcaggttgat
agttactttaaggaatttgctttcccttcagttaaaaaatcaactactttaaaacttgct
gaattaggaaatgaagctggagttataggtgcagcttcactagctttaaaatttaataag
tag

DBGET integrated database retrieval system