KEGG   Lactobacillus salivarius CECT 5713: HN6_01646Help
Entry
HN6_01646         CDS       T01962                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase class 3 (FBPase class 3) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 3)
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00010  Glycolysis / Gluconeogenesis
lsi00030  Pentose phosphate pathway
lsi00051  Fructose and mannose metabolism
lsi00680  Methane metabolism
lsi01100  Metabolic pathways
lsi01110  Biosynthesis of secondary metabolites
lsi01120  Microbial metabolism in diverse environments
lsi01130  Biosynthesis of antibiotics
lsi01200  Carbon metabolism
Module
lsi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01646
   00030 Pentose phosphate pathway
    HN6_01646
   00051 Fructose and mannose metabolism
    HN6_01646
  Energy metabolism
   00680 Methane metabolism
    HN6_01646
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HN6_01646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ADJ79875
Position
pHN3:complement(195490..197460)
Genome map
AA seq 656 aa AA seqDB search
MNFDDNEELVNKQVDMNAYSHNLLKEKYPTKQDVITEIMNLEAILHLPKGTEHFVSDLHG
EYTAFDHVLRNGSGSIKQKIQDYFSDRMTEQTMQDFALLIYYPEDELALVKKKLRTENEL
QQWYLDNISHLLEFLELSGSKYTRSKVRKALNPNFVYITEELLYNDPQEFNKRSYINQLL
KNILKLDQAGKFIIATCYTIQRLVVDHLHVLGDVYDRGEEPDKIMDRLMNYHSVDMQWGN
HDLLWLGAMAGSKLCMLNLLRICARYNNLNIIEDAYGINLRHLSRFAEEQYEDNPQFRPK
LTNGDGYRFNGEKLQITQIHQAVAMMQFKLEGKVIARRPELEMDDRDLLNKIDYKKNVIS
LNGKEYPLQNTCFNTVDPKNPSELTDEENAIVDELLISIQHSTKLKRHLDFMMNKGSMYR
TYNGNLLFHGCIPADEEGNFCSLKIGSKEYSGKKLFDFSEKMIRKAYSNPNVKDDFATDF
MWYLWQGALSPLFGKKSMTTFERYFIADKACHEEVKNPYYKLRENKDFCIKILQEFGFTG
DDTNHIINGHTPVKRGHNAICAEGYMLVIDGGYSKAYQPTTGIAGYTLLYNSYGLQLVSH
QPFTSKQDAIRSGKDIVSTVRVVKHELQRKSVADTDIGENIKEKIRVLYNLLRNYD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgatgataatgaagaattagtaaataagcaagttgacatgaatgcttattcg
cataacttattaaaagaaaaatatcctacgaaacaagatgtgattaccgaaattatgaac
ttggaagcaattttgcatcttccaaagggaactgaacactttgtaagtgatttgcatggg
gagtatacagcatttgatcacgttttaagaaatggttctgggagtattaaacagaaaatt
caagattacttttcagatagaatgacagaacaaacgatgcaagattttgctttgctaatc
tactatcctgaagatgaattggctctagtaaagaaaaaattacgtacagaaaatgagcta
caacaatggtacttagataacatttcccacttattagaatttttagaattatcaggaagc
aagtatacgcgctcaaaggttcgtaaagcactaaatcctaattttgtatacataacagaa
gaattattatataacgatccacaagaatttaataagagaagttatattaatcaacttttg
aagaatattttgaaattagatcaagcaggtaaatttattattgctacctgttacacaatt
caaagattagtagtagatcacttacatgttctgggcgatgtttacgataggggagaagaa
ccagacaaaattatggatagattgatgaattatcattctgtcgatatgcaatggggaaat
catgatttactatggctaggtgcaatggcaggctcaaaactatgtatgttgaatttattg
agaatttgtgcaagatataataacttgaacatcatagaagatgcttatgggattaactta
cgtcacctttcgagatttgctgaggagcaatatgaggataatcctcaatttagacctaaa
ttgactaatggtgatgggtatagattcaacggcgaaaagctacaaatcacgcaaattcat
caagctgttgcgatgatgcaatttaagcttgaagggaaagttatagctagaagaccagaa
ttggaaatggatgatcgagatttacttaataagatagattacaagaaaaatgtaattagt
ttaaatggtaaagaatatccgttacaaaatacttgtttcaacactgtagaccctaaaaat
cctagtgaattaacagatgaagaaaatgcgattgtagatgaattattaatttccattcaa
cattctacaaaattaaaacgtcatctagattttatgatgaataaaggtagtatgtaccgt
acatataatggcaatctcttattccatggatgtattcctgcagatgaagaaggaaatttc
tgtagcttgaagattggtagtaaagaatattctggcaaaaaattgtttgatttttctgaa
aaaatgattcgaaaagcttactctaatccaaatgtaaaagatgattttgccactgatttt
atgtggtatttatggcaaggagctctttccccactgttcggtaagaaatctatgactact
tttgaacgttattttattgcagataaagcttgtcatgaagaagtaaagaatccatattat
aaattaagggaaaataaggatttctgcatcaaaattttacaagaatttggatttactggc
gatgatactaatcatattatcaatggtcacactccagttaaaaggggacataatgcaatc
tgcgcagagggttatatgttggtaattgatggaggatactccaaagcctatcagccaaca
acagggatcgctggatatacattattgtataattcatatggcttgcaactagtttcgcat
caaccatttacttcaaaacaagatgctattagaagcgggaaagatatcgtttcaacggtt
cgagtggtaaagcatgaattacaacgaaaatcagttgcggatactgatattggtgaaaat
attaaagaaaaaattagagttttgtataatttattgagaaattatgattag

DBGET integrated database retrieval system