KEGG   Lactobacillus salivarius JCM1046: LSJ_0032Help
Entry
LSJ_0032          CDS       T03340                                 

Gene name
gldA
Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lsj  Lactobacillus salivarius JCM1046
Pathway
lsj00561  Glycerolipid metabolism
lsj00640  Propanoate metabolism
lsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LSJ_0032 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LSJ_0032 (gldA)
Enzymes [BR:lsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LSJ_0032 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Herpes_UL73
Motif
Other DBs
NCBI-ProteinID: AIR09805
UniProt: A0A089QAP5
Position
37030..38139
Genome map
AA seq 369 aa AA seqDB search
MTTNYMSNYSYGPDCFKEIPEVLDKYKVHKVVFIGGEKALKSSQEDVKNVLESNGFYVTG
SFVYGKNATQANIDKLVEKSEVQDADIIFGFGGGRALDTVKMVAKALDKTIFTFPTICSN
CSAGTAIAVLYKDDGSFDKYGYPDVPAHVFINTSVIAKAPKEYFWAGVGDGISKAPEVEH
AVAAAVERGVELPHTAVLGAAIAASSKDAFYKYGEQGIKDVENGTVSKAIEEVALDIVVS
TGYASNLVNQDDFYYNSCHAHAFYNATTAIKKEKEPLHGQVVSFGVMVLHAYFNELEELK
KVAAFNKKLGLPVTLEEMGLKVSDAEKITELAMQTNEYKQTPFDKEKYIEAIKLADKMGS
ENAQHFFKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaattatatgagtaactatagctatggcccagattgttttaaagagattcca
gaagttttagataaatataaagtacataaagttgttttcattggtggagaaaaagcatta
aagagttctcaagaagatgtgaaaaatgttctggaaagtaatggattctatgtaactgga
agttttgtttacggaaaaaatgcaactcaagcaaatatagataaattggtagaaaaatct
gaagttcaagatgcagatataatttttggttttggtggaggtcgagcattagatactgta
aaaatggtagcaaaagctttagataagactatttttacattcccaacaatctgttcaaat
tgttcagctgggactgctattgctgttttgtataaagatgatggttcatttgataagtat
ggatatcctgatgtgccagcacatgttttcattaatacaagtgtgattgctaaagcaccg
aaagaatatttttgggcgggagtaggtgatggtattagtaaggctcctgaagtagaacat
gcagtagctgcagcagttgaacgtggtgtggaattgcctcatacagcagtattaggtgca
gcaattgcggcttcttccaaagatgctttctataagtatggggaacaaggaattaaagat
gtggagaatggaactgtaagtaaggctatcgaagaagtagctctggatattgtagtttca
acaggttatgcttcgaacttggtaaatcaagatgatttttactataattcatgccatgct
catgctttctacaatgcaacaacagcgattaaaaaggaaaaagaaccattgcatggacaa
gttgtttccttcggggtaatggtgttacatgcttatttcaatgagttagaggaattaaag
aaagtagctgcttttaataaaaaattgggattaccagtaacattggaagaaatgggatta
aaggttagcgatgcagaaaaaataacagaacttgcgatgcaaactaatgaatataaacag
accccatttgataaggaaaaatacatagaagcaattaaattggcagataagatgggtagt
gaaaacgcccaacattttttcaaagtgtaa

DBGET integrated database retrieval system