KEGG   Lactobacillus salivarius UCC118: LSL_0313Help
Entry
LSL_0313          CDS       T00337                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00260  Glycine, serine and threonine metabolism
lsl00261  Monobactam biosynthesis
lsl00270  Cysteine and methionine metabolism
lsl00300  Lysine biosynthesis
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
lsl01120  Microbial metabolism in diverse environments
lsl01130  Biosynthesis of antibiotics
lsl01210  2-Oxocarboxylic acid metabolism
lsl01230  Biosynthesis of amino acids
Module
lsl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
lsl_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSL_0313 (asd)
   00270 Cysteine and methionine metabolism
    LSL_0313 (asd)
   00300 Lysine biosynthesis
    LSL_0313 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    LSL_0313 (asd)
Enzymes [BR:lsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     LSL_0313 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC Gp_dh_C DapB_N NAD_binding_10 RmlD_sub_bind Epimerase DXP_reductoisom Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 3977333
NCBI-ProteinID: YP_535209
UniProt: Q1WV59
Position
complement(342157..343248)
Genome map
AA seq 363 aa AA seqDB search
MSQKLKVAVIGATGMVGQRFIAILDNHPWFEVTELAASPRSAGKTYEEALNGRWRMETPI
PERVKDMVVLDANDVEKVTSNVDFVFSAVSMSKDEIKALEERYAKTETPVVSNNSAHRWT
PDVPMIIPEINPEHTEVIKYQRERLGTKRGFIAVKPNCSIQSYTPALSAWKKFEPYEVVA
TTYQAISGAGKTFKEWPEMEGNIIPFISGEEEKSEKEPLRIWGHVDAESKSIVPADDTVI
TTQCVRVPVLYGHTAAAFVKFRKPATKEELIKALEDYRGVPQELELPSAPKQFIRYMTED
DRPQVALDVNYENGMGVSIGRLREDKVYDWKFIGLSHNTARGAAGGAVECAELLKAQGYI
TKK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattaaaagtagcagttattggtgctactggtatggttggacaaagattt
attgcgattttggataaccatccctggtttgaagttacagaattagcagctagtcctcgt
agtgctggtaaaacttacgaagaagctcttaacggtcgctggcgtatggaaacacctatt
cctgaacgtgttaaggatatggttgttttagatgctaatgatgtagaaaaagttacttct
aatgtagactttgtattttcagctgtcagcatgtctaaagatgaaattaaagcacttgaa
gaaagatatgctaaaactgaaactcctgttgtttctaataatagtgctcatcgttggact
ccagatgttcctatgattatccctgaaattaatcctgaacatactgaagttatcaaatac
caacgtgaacgtttaggtacaaaacgtggctttatcgcagttaaaccaaattgctctatc
caaagctacacaccagcattatctgcttggaagaaatttgaaccttatgaagtagttgct
actacatatcaagctatctccggtgccggaaagactttcaaagaatggccagaaatggaa
ggtaacatcattccatttattagtggcgaagaagaaaaatcagaaaaagaacctcttcgt
atttggggtcatgtagatgctgaaagtaagtctattgtcccagctgatgatacagttatt
actactcaatgtgttcgtgtaccagtgctttacggacatactgcagctgcttttgttaaa
ttcagaaaacctgctactaaggaagaattaattaaagcacttgaagattatcgtggtgtt
ccacaagaattagaacttcctagtgctcctaaacaattcattcgttatatgactgaagat
gaccgtcctcaagttgcattagatgtaaactacgaaaatggtatgggcgtttctatcggt
cgtttacgtgaagataaagtatatgactggaaattcatcggtctatcacacaacactgct
cgtggtgctgctggtggcgctgttgaatgtgctgaattattaaaggctcaaggttatatc
actaaaaaataa

DBGET integrated database retrieval system