KEGG   Lactobacillus salivarius UCC118: LSL_0533Help
Entry
LSL_0533          CDS       T00337                                 

Gene name
folD
Definition
(RefSeq) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00670  One carbon pool by folate
lsl01100  Metabolic pathways
lsl01120  Microbial metabolism in diverse environments
lsl01200  Carbon metabolism
Module
lsl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LSL_0533 (folD)
Enzymes [BR:lsl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     LSL_0533 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     LSL_0533 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 3976491
NCBI-ProteinID: YP_535425
UniProt: Q1WUJ3
Position
576669..577526
Genome map
AA seq 285 aa AA seqDB search
MVATILDGRMLSKKIRTNVSEKVSLLKQEGITPKLVVILVGEDPASQVYVRNKRKTAHAL
GIEAVDIRLPENVEEDELIRLIDELNSDGTVHGILVQLPLPKHINENKVTHRIIPEKDVD
GFHPLNIGKLFMNIPGPLPCTPRGIMEFFKEYDIPVSGKRVVIVGRSNIVGRPMAALLVN
SDATVTIAHSKTKNLAEVTKQADILIVAIGKGEFIDENYVKKGAVVIDVGMNRNNDGKLV
GDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERSVAGE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaacaatattagatgggcgaatgttatctaaaaaaataagaactaatgtatct
gaaaaagttagcttattaaaacaagaagggataactccaaaattagtagtaattttagta
ggcgaagatcctgctagtcaagtttacgtaagaaataaaagaaaaactgcacatgcgtta
ggtatagaagctgtagatattagattgcctgaaaatgttgaagaagatgaattaattagg
ttaattgatgaattaaatagtgatggaactgttcatggtattttagtacaattgccgtta
ccaaaacatataaatgaaaataaagtaacccatagaattatacccgaaaaagatgtagat
ggatttcatcctttaaatatcggaaaactatttatgaatatacctggaccattaccttgt
accccaagaggaattatggaatttttcaaggaatatgatattcctgtttcaggaaaaaga
gttgtaattgttggtagaagtaatattgtaggtagaccaatggctgcattgttggtaaat
agtgatgctactgtaacaatagcgcatagtaagaccaagaatttagctgaagtgacaaag
caagctgatattttgattgttgctattggtaaaggtgagtttatagatgaaaattatgta
aagaaaggagctgttgtgatagacgtgggtatgaacagaaataatgatggaaaattagtt
ggcgatgttaatatggaaagtgtgagcaaagtagccagctatataaccccagttcctggt
ggtgtagggccaatgacaattgcaatgttgatgaaacaaacagtagaattagcagaaaga
agtgttgctggtgagtaa

DBGET integrated database retrieval system