KEGG   Lactobacillus salivarius UCC118: LSL_0552Help
Entry
LSL_0552          CDS       T00337                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00010  Glycolysis / Gluconeogenesis
lsl00052  Galactose metabolism
lsl00500  Starch and sucrose metabolism
lsl00520  Amino sugar and nucleotide sugar metabolism
lsl00521  Streptomycin biosynthesis
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
lsl01120  Microbial metabolism in diverse environments
lsl01130  Biosynthesis of antibiotics
lsl01200  Carbon metabolism
Module
lsl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_0552
   00052 Galactose metabolism
    LSL_0552
   00500 Starch and sucrose metabolism
    LSL_0552
   00520 Amino sugar and nucleotide sugar metabolism
    LSL_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSL_0552
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LSL_0552
Enzymes [BR:lsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSL_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 3976510
NCBI-ProteinID: YP_535444
UniProt: Q1WUH4
Position
592926..593888
Genome map
AA seq 320 aa AA seqDB search
MNKKLIGVDLGGTTIKFAILTLDGEIQQKWSVETNILDDGKHIVPDIVESINHHLDLYDM
KPEQFVGIGMGTPGTVDIENGTVEAAFNLNWKEKQNLKEEIEKGTGMKFAVDNDANVAAL
GERWKGAGENDDEVTFVTLGTGVGGGVITNGEMVHGAGAGGEIGHINVQPNGYLCTCGNH
GCLETYASATGVVRVARDMAEEFAGKSDLKKMLDDGQDISSKIVFDLAKDGDVLAERVVD
RVCYYLGFACANIGSLINPSYIVIGGGVSAAGKFLLDQVDSYFKEFAFPSVKKSTTLKLA
ELGNEAGVIGAASLALKFNK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagttaattggtgttgatttaggcggtacaacaattaaatttgctatcttg
acactagatggtgaaattcaacaaaaatggagtgttgaaactaatattttagacgatggt
aaacatattgttcctgatattgttgaatcaattaatcatcatttagatttatatgatatg
aagccagaacaatttgttggaattggaatgggtacaccgggaacagtagatattgaaaat
ggtacagttgaagcagcatttaacttgaactggaaagaaaagcaaaatctaaaagaagaa
attgaaaagggcactggtatgaagtttgctgtagataatgatgccaatgtagcagcattg
ggtgaacgctggaaaggtgccggagaaaatgatgatgaagtaacatttgttacattaggt
acaggtgttggtggtggtgtcatcactaatggtgaaatggttcacggagctggagctggt
ggtgaaattggtcatataaatgtacaaccaaatggctatttgtgtacttgtggaaatcat
ggctgtttagaaacttatgcttctgcaacaggtgttgtacgtgttgcacgtgatatggct
gaagaatttgctggaaaatctgatttaaagaaaatgttagatgatgggcaagatattagt
tctaagatagtatttgatttagcaaaagatggcgatgttttagctgaacgtgttgtggat
cgtgtttgctactatttaggatttgcttgtgctaatattggtagtcttatcaatccatca
tatattgtaatcggtggtggcgtttctgcagcaggtaagttcttattagatcaagttgat
agttactttaaggaatttgctttcccttcagttaaaaaatcaactactttaaaacttgct
gaattaggaaatgaagctggagttataggtgcagcttcactagctttaaaatttaataag
tag

DBGET integrated database retrieval system