KEGG   Lactobacillus salivarius UCC118: LSL_1467Help
Entry
LSL_1467          CDS       T00337                                 

Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00300  Lysine biosynthesis
lsl01100  Metabolic pathways
lsl01120  Microbial metabolism in diverse environments
lsl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSL_1467
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LSL_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Osteoregulin Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 3977823
NCBI-ProteinID: YP_536354
UniProt: Q1WS58
Position
complement(1527832..1528968)
Genome map
AA seq 378 aa AA seqDB search
MNEMDKIKVLADIVEIPSVNDDEVSVAKYIRDLFAKYGIESKILKVKGNRANLVAEIGEK
GPILGFSGHLDVVAAKESDGWHSDPFKLVERDGKLYGRGTSDMKSGVAAMIVSLIELQQK
GLKNGRIRLMLTMGEEIGEEGSAYFYEHGYMKDVSALVISEPTYYRIIYAEKGSLDLKIT
SRGKAAHSSMPNLGYNAVNPLIELLSELNEFFSNPPKNDVLGPLTFNVTVFKGGEQVNTI
PDYAEAEINVRTLPNFDGNDVIKKLDEYLEKKNENGATLTREVLMNEDAVLKSPDSVIAD
LAAEIVESRGREVVKTIAPGITDASNLLKEKKEDYPFIVFGPGNPLVSHQVDEYVEKKAY
LDFIDIYQELAEKYFIND
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatggataaaatcaaagtattagcagatattgttgaaatcccatcagtaaac
gatgatgaagtgagtgtagctaaatatataagggatttatttgcaaaatatggaatcgaa
tctaaaattttaaaagttaaagggaacagggccaatttagttgcagaaataggagaaaaa
ggtcccattctaggattctcagggcatttagatgtagttgcagctaaggaaagtgatggt
tggcatagtgatccatttaaattagttgaaagagatgggaaactttatggtcgcggaaca
tcagatatgaagtctggggtagcagcgatgatcgtttctttaattgaattgcagcaaaaa
ggattaaaaaacggaagaattcgcttgatgctgacaatgggtgaagaaataggggaagaa
ggatcagcatatttttacgaacatggctatatgaaagatgtttctgccttagtgattagt
gaacctacgtattacagaataatttatgcggaaaaaggttcattagatttgaagattact
tctagaggtaaagctgcacatagttcaatgccaaatcttgggtataatgctgtaaatcca
ctaattgaattacttagtgaattaaatgaatttttcagtaatccaccaaaaaatgatgta
ttagggccacttacattcaatgtgacagtctttaaaggtggagaacaagtaaatacaatt
cctgattacgctgaagcggaaattaatgttcggacattacctaattttgacggaaatgat
gtaattaagaagttagatgaatatcttgaaaagaaaaatgaaaatggcgctacattaacg
agagaagttttaatgaatgaagatgcagtactaaaatcaccagattcagtaattgctgat
ttagctgctgaaattgttgaaagccgtggaagagaagtcgttaagaccattgcaccaggt
attacggatgcttctaatttactaaaggaaaagaaagaagattatccatttatagtattt
ggtccaggtaatccattggtaagtcatcaagtagatgaatatgtggaaaagaaagcttat
ctagattttattgatatttatcaagagttagctgaaaaatattttattaatgattag

DBGET integrated database retrieval system