KEGG   Lactobacillus salivarius UCC118: LSL_1901Help
Entry
LSL_1901          CDS       T00337                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00010  Glycolysis / Gluconeogenesis
lsl00350  Tyrosine metabolism
lsl00620  Pyruvate metabolism
lsl00625  Chloroalkane and chloroalkene degradation
lsl00626  Naphthalene degradation
lsl00650  Butanoate metabolism
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
lsl01120  Microbial metabolism in diverse environments
lsl01130  Biosynthesis of antibiotics
lsl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1901
   00620 Pyruvate metabolism
    LSL_1901
   00650 Butanoate metabolism
    LSL_1901
  Lipid metabolism
   00071 Fatty acid degradation
    LSL_1901
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSL_1901
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSL_1901
   00626 Naphthalene degradation
    LSL_1901
Enzymes [BR:lsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSL_1901
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LSL_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 3978373
NCBI-ProteinID: YP_536790
UniProt: Q1WQZ1
Position
pMP118:complement(191470..194127)
Genome map
AA seq 885 aa AA seqDB search
MVNKTNNKEEDARVYTDGLVEKALKAEQEYSTFSQEQVDKIVAAAALAGSEAALILAHEA
VDETGRGVVEDKDTKNRFATENVYNAIKNDKTVGVIEEDKIKGEVKIAAPLGVLAGIVPT
TNPTSTAMFKSLLALKTRNAIVFAFHPQAQKSSAHAAKIVYDAAVKAGAPKNIIQWIEEP
SLEKTTALIQNPKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDHTAHLDRAVED
LLLSKRFDNGMICATENSAVVEAPIYDEWLKKMEEKGAYVVPKKDYKKIEDFVFNDRHGV
NGPVAGKPARWIAEQAGVELPEGKDVMLFELSAKNIGEKLSSEKLSPLLSVYKAKDREDG
IKTVAALLDYQGAGHNAAIQIGSQSDPFVKEFGDRTKAARILVNQPDSIGGIGDIYTDGL
RASLTLGTGSWGKNSLSHNLSTSDLLNVKTVAKRRNRPQWVRLPEKIYYEKNAISYLQDE
TEDINRAFIVADPGMVKFGFVDKVYDQLAARENEVKTALYGTVRPDPMLGQTIEIAQQMA
QFEPDTVIAIGGGSALDATKIARYIYEYSLDQEPGFLDSYEKVSEVFKELQQKFVDIRKR
IVKFHHAKKTRMFAIPTTSGTGSEVTPYAVITDDNTHVKYPLTDYELTPQVSIVDPEFVM
TVPKRTVALSGLDSLSHALESYVSVMASDFTRPWSMQAIKLVFENLEASYNYDPKHPTLE
GEKARENMHYAATLAGMAFANAFLGINHSIAHKTGGEFGLPHGLAISIAMQHVIKFNGAS
GRVKRTPFPRYEVYRAQKDYADIARALGLKGNSDAELVDALCNKINDLMKKLDVEPKLSA
NGVTKEQFEKALDKMVDRVYDDQCTTANPRQPYLEEIRQLLIDQF
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggttaacaagacaaacaacaaagaagaagatgctcgtgtatacactgatggtttagta
gaaaaagcattaaaagctgaacaagaatattctactttctcacaagaacaagtagataag
attgttgcagcagctgctttggctggctcagaggctgctttgattttagctcatgaagca
gtagatgaaactggacgtggggttgtagaagataaggatacaaagaaccgtttcgcaact
gaaaatgtctataatgctattaagaatgataaaacagttggtgtaattgaagaagataag
attaaaggcgaagtaaaaattgcagctccacttggtgttttagcaggtattgtacctaca
acaaacccaacatcaacagcaatgtttaagtcattattagcattgaagactagaaacgca
attgtattcgctttccacccacaagctcaaaagagttcagcacatgctgcaaagatcgtt
tatgatgcagctgtaaaagctggtgctccaaagaacattattcaatggattgaagaacca
agtctagaaaagacaacagctcttattcaaaatccaaagattgcttctattttggctact
ggtggtccaggaatggttaatgcagctttgaagtctggtaatccatcaatgggtgtaggt
gctggtaatggtgctatctacgttgatcatacagcacaccttgacagagctgttgaagat
ttacttctatctaagagatttgataacggtatgatttgtgctactgaaaactctgcagtt
gttgaagctcctatctatgatgaatggctaaagaagatggaagaaaaaggagcatacgtt
gttcctaagaaagactataagaagattgaagatttcgtattcaatgatagacatggtgta
aatggtccagttgctggtaagccagctcgctggattgctgaacaagctggtgtagaactt
ccagaaggtaaagatgtaatgttatttgaactttctgctaagaacatcggtgaaaagcta
tcatctgaaaaactttctccattattgtcagtatataaagcaaaagatcgtgaagatggt
attaagaccgttgctgcattattagattatcaaggtgcaggccataatgctgctatccaa
attggttctcaatccgatccatttgtaaaagaatttggtgatagaactaaagcagctcgt
atcttggtaaatcaacctgattccattggtggtattggtgatatttacacagatggctta
cgtgcaagtttgacacttggaacaggatcatgggggaagaattcattgtcacataattta
tcaacatcagacctattaaatgttaagacagttgctaagagacgtaacagacctcaatgg
gttcgtttaccagaaaagatctactacgaaaagaatgctatcagctatctacaagatgaa
actgaggatatcaaccgtgcattcatcgtagctgacccaggaatggttaagtttggattt
gtagacaaagtttacgatcaattagcagcaagagaaaatgaagttaagacagctctttat
ggaactgtaagacctgacccaatgttaggacaaacaattgaaattgctcaacaaatggca
caattcgaaccagatacagttattgctatcggtggtggttccgcattggatgctacaaag
attgctcgttacatctatgaatactccttagatcaagaaccaggattcttagatagctac
gaaaaagttagtgaagtatttaaagaattacaacaaaaattcgttgatatccgtaagaga
attgttaagttccatcacgctaagaagacaagaatgtttgcaattccaacaacatctggt
acaggttctgaagtaacaccatatgctgttattacagatgacaatacacatgttaagtac
ccattaacagactacgaattgacaccacaagtatcaatcgtagacccagaatttgttatg
actgttcctaagagaactgtagcattatctggattggatagtttatcacatgctcttgaa
tcatatgtatcagttatggcatctgacttcacacgtccatggtcaatgcaagctatcaag
ttagtatttgaaaacttggaagcttcatacaactacgatccaaaacatcctacattggaa
ggggaaaaggctcgtgaaaacatgcactatgctgcaacattagctggtatggcatttgct
aatgcattcttaggtatcaaccactcaatcgctcacaagactggtggggaatttggatta
ccacatggtttggcaatttccattgctatgcaacacgtaattaaatttaacggtgcttct
ggtcgtgtaaaacgtacaccattcccacgttatgaagtatatcgtgctcaaaaagactat
gcagatattgctcgtgcattaggcttgaaaggcaactcagatgctgaattagtagatgca
ttatgcaacaagattaacgatttaatgaagaaattagacgttgaacctaagttatctgca
aatggtgtaactaaagaacaatttgaaaaagctcttgataagatggttgatcgtgtttac
gatgatcaatgcacaactgcaaatcctcgtcaaccatacttggaagaaattcgtcaattg
ttgatcgatcaattctaa

DBGET integrated database retrieval system