KEGG   Lactobacillus sanfranciscensis: LSA_01210Help
Entry
LSA_01210         CDS       T01627                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00071  Fatty acid degradation
lsn00072  Synthesis and degradation of ketone bodies
lsn00280  Valine, leucine and isoleucine degradation
lsn00362  Benzoate degradation
lsn00620  Pyruvate metabolism
lsn00630  Glyoxylate and dicarboxylate metabolism
lsn00640  Propanoate metabolism
lsn00650  Butanoate metabolism
lsn00900  Terpenoid backbone biosynthesis
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01200  Carbon metabolism
lsn01212  Fatty acid metabolism
lsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LSA_01210 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LSA_01210 (atoB)
   00640 Propanoate metabolism
    LSA_01210 (atoB)
   00650 Butanoate metabolism
    LSA_01210 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LSA_01210 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LSA_01210 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LSA_01210 (atoB)
   00310 Lysine degradation
    LSA_01210 (atoB)
   00380 Tryptophan metabolism
    LSA_01210 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LSA_01210 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LSA_01210 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LSA_01210 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsn04147]
    LSA_01210 (atoB)
Enzymes [BR:lsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LSA_01210 (atoB)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSA_01210 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEN98603
UniProt: G2KUT5
Position
complement(119000..120235)
Genome map
AA seq 411 aa AA seqDB search
MTHKTGIIELNHIRRSLQELKKIAIVSAKRTPIGKINGQLSSLNSVDLGVIAAKSTMNSI
NLDPKLVDQVIFGNVIQAGGGQNIARQIELKSGIPDTSTACTINQVCGSGMKAIRLGQQA
ILTNDADIVLVGGTESMSNAPYLNSKVRQGRKFGAFTMEDSIEKDGLNDFRTNAPMGITA
ENVAEKFNISRAAQDQFALSSHQKAAKAIKNNYFAAEMTPITIRGKKTATVISTDETVRP
DTTIEQLAKLRTSFKENGTVTAGNAASLNDGASALIMMTEDRAKELNLKPLAIIDNYAEA
GCNPDIMGYAPRYAVEKLLKKEQKNISDYDLFELNEAFASQSLAVVNDLHIPMEKLNITG
GAVALGHPLGDSGARILITLINNLKRTNQKSGIATLCIGGGMGMAMSIHIN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atcactcataagacaggtataatagaattaaatcacatacgaaggagtcttcaagaattg
aaaaaaattgcaatcgtgagtgctaaacgaaccccaattggaaaaatcaacggacaacta
agtagtctaaactcagttgaccttggagtaatcgctgctaaatcaacaatgaactccatt
aatttagatccaaaactagtagatcaagtaatctttggaaatgtaattcaagctggcggt
ggtcaaaatattgctcgtcaaattgaactaaagtctggaattcctgataccagtactgct
tgtacaatcaaccaggtttgtggttctgggatgaaagcaatccggcttgggcagcaagca
atcttaaccaatgatgctgatattgttttagttggtggaaccgaaagtatgtcaaatgct
ccttatttaaattctaaggttcgtcaaggtcgcaaatttggtgcatttactatggaggat
agtattgaaaaagatggattaaatgacttccgcacaaacgctcccatgggaattacggcc
gaaaatgtagctgaaaaatttaacatatctcgtgcagctcaagatcaatttgctctttca
tctcaccaaaaagctgctaaagcaattaaaaataactattttgcagcagaaatgaccccg
ataacaattcgtggcaaaaaaacagcaacggtaatttcaactgatgaaaccgttcgtcct
gacactactattgaacaattagcaaagcttagaacatcatttaaggaaaacggaaccgta
actgctggaaacgcggctagtctaaatgatggtgcatcggcattaatcatgatgacagaa
gatcgtgctaaagaacttaatttaaagcctttagcaatcatcgataattatgcagaagca
ggatgtaaccccgatatcatgggatatgctcctcgttatgccgttgaaaagttattgaaa
aaggaacaaaaaaacatctctgattatgatttatttgaattgaacgaggcctttgcttct
caaagtttagcggttgtcaatgaccttcatattccaatggaaaaattaaatatcaccggt
ggtgccgtcgctttgggtcatccgcttggggattcaggagctagaattctaattaccctc
atcaacaatttaaaaagaactaaccaaaaatctggaattgcaaccctttgtatcggtggt
ggtatgggaatggcaatgagcattcacattaattaa

DBGET integrated database retrieval system