KEGG   Lactobacillus sanfranciscensis: LSA_03840Help
Entry
LSA_03840         CDS       T01627                                 

Gene name
gpmA2
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00010  Glycolysis / Gluconeogenesis
lsn00260  Glycine, serine and threonine metabolism
lsn00680  Methane metabolism
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01200  Carbon metabolism
lsn01230  Biosynthesis of amino acids
Module
lsn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_03840 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    LSA_03840 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSA_03840 (gpmA2)
Enzymes [BR:lsn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSA_03840 (gpmA2)
Membrane trafficking [BR:lsn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LSA_03840 (gpmA2)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSA_03840 (gpmA2)
  Exosomal proteins of melanoma cells
   LSA_03840 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEN98832
UniProt: G2KU17
Position
357064..357762
Genome map
AA seq 232 aa AA seqDB search
MAKLCLIRHGQSEWNLANKFTGWVDVDLSEEGVKQAKHAGKLIADAGLEFDQAYTSVLKR
AINTLHYALGESNQLWIPEMKSWRLNERHYGALQGHNKERAAEKYGADQVHIWRRSYDVL
PPLLSADDEGSATKDRRYADLDPRAIPAGENLKTTLERVIPFWQDEIAPKLLDHKNVIIA
AHGNSLRALTKYIEGISDEDIMDVEIATGDPIVYDIDENLNIVSKTKLDENR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattatgtttaattcgtcacggacaaagtgaatggaacttagcaaacaaattc
actggatgggttgatgttgatctaagtgaagaaggagttaagcaagctaaacatgcaggt
aagttaattgccgatgccggtcttgaatttgaccaagcttacacttcagttttaaaacgt
gccattaacacattgcactatgctttaggtgaaagtaaccaattatggattccagaaatg
aaatcatggcgtttaaacgaacgtcattacggtgctttacaaggtcacaacaaagaacgt
gctgctgaaaagtacggtgcagaccaagttcacatttggcgtcgttcatatgatgttttg
cctccactattgagtgccgatgatgaaggttcagcaactaaagaccgtcgttacgctgat
ttagacccacgtgcaattcctgcaggtgaaaatcttaaaaccactttggaacgtgtaatt
ccattctggcaagatgaaattgctcctaaattattagatcacaagaacgtaatcattgct
gcacatggtaactcattacgtgccttaactaaatacatcgaaggtatttctgatgaagat
atcatggatgtagaaattgctactggtgatccaattgtttacgacattgacgaaaactta
aacatcgtaagtaaaactaagttagacgaaaacagataa

DBGET integrated database retrieval system