KEGG   Lactobacillus sanfranciscensis: LSA_10700Help
Entry
LSA_10700         CDS       T01627                                 

Definition
(GenBank) hypothetical protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00300  Lysine biosynthesis
lsn01100  Metabolic pathways
lsn01120  Microbial metabolism in diverse environments
lsn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSA_10700
Enzymes [BR:lsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LSA_10700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DUF2007
Motif
Other DBs
NCBI-ProteinID: AEN99464
UniProt: G2KVT5
Position
complement(1044962..1046185)
Genome map
AA seq 407 aa AA seqDB search
MNKEEKLAILEKLVSFNTSEGNELAEAQYLQDLLLEHGIESEIENLGNHEANLIAEIGNG
QKPVFTISGHLDTVAVDVDKWDTDPFTLVRKDGQMYGSGVTDMKGGTAALVIAMITLKDA
EFPLNGTLRLVLTAGEESNMHGSHQLYADGAMNDSDTLLIAEPTGYRTVYANKGEVDFKI
TAQGKAAHSSRPNFGINAIQNLMDVLELIKTKVEARAEQNQDDVLGKTTFTVDIFKGGIQ
INAIPANAKAEINTRIVPEYSNDEVMADVKAVVDEFNQTHAGEIEIEILMNIPPVIGNPE
SKLIKDIIKIATSYMKNTEYTPSEKQQGKEMQAKQGFNPFSNDKFDVLSGAGGTDASELL
KDKLMGTNYAVFGPGNPLKMHQTNEYASEQMWFDFIDIYEKLFKEYL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaagaaaaattagcgatattagaaaaattagttagttttaacacctcagaa
ggtaacgaacttgccgaggctcaatatttacaagacttgttgttagaacacggaatcgaa
agtgaaattgaaaatttaggcaatcatgaagctaatttaattgcagaaattggaaacgga
caaaaaccggttttcacgattagtggacatttagatacagtggcggtcgatgtcgataaa
tgggatactgatccatttactttagttcgtaaagacggccaaatgtatggaagtggtgtg
actgacatgaaaggtggcactgctgcattagtgattgccatgattactctaaaagatgct
gagtttccattgaatggaacgttacgtttagttttaacggccggcgaagaatcaaatatg
cacggttctcaccaattatatgctgacggagccatgaatgattcagacacgcttttaatt
gctgaaccaactggctaccggacagtttacgccaacaagggtgaagtcgactttaagatt
accgcacaaggaaaagccgcacatagttcacggcctaactttgggattaatgcgattcaa
aatttaatggatgttttagaattaatcaaaacgaaagttgaagctcgagctgaacaaaat
caagatgatgttttagggaaaacaacctttacagtcgatatcttcaaaggtggaattcaa
attaatgcaattcccgcaaatgctaaagctgaaattaacacgcggattgtgcctgaatat
tctaatgatgaagttatggcagatgtgaaagccgttgttgatgagtttaaccaaactcat
gctggtgaaattgaaattgaaattttaatgaacattcctccagttatcggaaatccagaa
tcaaaattaattaaagacattattaaaattgctacttcttacatgaaaaacaccgaatac
actccttcagaaaaacaacaggggaaagaaatgcaagctaagcagggattcaatcctttt
tcaaatgataagtttgatgtattgagtggtgctggcggaacggatgcttctgagttactt
aaagataaattaatgggaactaactacgccgtctttggtccaggtaacccattgaaaatg
caccaaaccaatgaatatgcttcagaacaaatgtggtttgattttattgatatttatgaa
aaattgtttaaagaatatttgtga

DBGET integrated database retrieval system