KEGG   Candidatus Liberibacter solanacearum: CKC_01245Help
Entry
CKC_01245         CDS       T01373                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00300  Lysine biosynthesis
lso01100  Metabolic pathways
lso01120  Microbial metabolism in diverse environments
lso01230  Biosynthesis of amino acids
Module
lso_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CKC_01245
Enzymes [BR:lso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CKC_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADR52000
UniProt: E4UCB0
Position
240827..241924
Genome map
AA seq 365 aa AA seqDB search
MLADTLKPLGFSIKQQIFQEENTPDVKNIYARFGVKKPHLMFAGHVDVVPPGNLDEWMYP
PFSATVAEGRIYGRGAVDMKGSIACFIAAVSRFIPKHTNFGSISLLITGDEEGPAINGTK
KMLSWAKKNGEQWDACIVGEPTCSHILGDTIKIGRRGSLSGEIIIHGTQGHVAYPHLANN
PIKGLIPLLHQLTTIEFDTGNTDFPSTNLEITTVDVGNPAKNIIPAKVKISFNIRFNNLW
NEQTLKKEIESRLTKSLQNMPKLSYNLHFSSPVSPVFLTDNKTLTSLLSESIHRVTGGTP
QLSTTGGTSDARFIKDHCPVIEFGLVGKTIHAVNENVLLKDLEDLTCIYEDFLHNWFISS
SLSIE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgatactttaaaacctcttggcttttccatcaaacaacaaatttttcaagaa
gaaaatacacccgacgttaagaatatttatgctcgttttggtgtaaaaaaaccccattta
atgtttgctggacacgttgatgtcgttcctcctgggaatcttgatgaatggatgtatcca
ccattttcagctaccgttgcagaaggaagaatatatggacgcggagctgttgatatgaag
ggaagcattgcttgttttatagccgccgtttctagatttattccaaaacatacaaatttc
ggatctatttcccttctaattaccggagacgaagaaggccctgcaataaatggaacaaaa
aagatgctttcatgggcaaaaaaaaacggagaacaatgggatgcatgcatagtaggagag
ccaacctgtagccatatcctcggagatacaataaaaataggacgcagaggcagtctctcc
ggtgaaatcataatccatggaacacaaggacatgtagcttatccacacctagcaaacaat
ccaataaaaggacttatcccattactgcatcaattaacaaccatagaatttgacaccggt
aatactgattttccttcaacaaatctagaaataacgacagtagacgtaggaaatcctgca
aaaaacattatcccagcaaaagtaaaaatctcttttaacatacgctttaacaatctatgg
aacgaacaaaccttaaaaaaagaaatagaatctcgactaacaaaaagcttacaaaatatg
ccaaaattatcttataacctacacttttcatcacctgtaagccctgtttttttaacagat
aacaagacactaacctctttgttaagcgaaagtatccatcgtgtaactgggggaacaccc
caattatctacaactggaggaacgtctgatgcccgctttatcaaagatcactgcccagtt
atagagtttggacttgtaggaaaaacaattcacgcagtgaatgaaaacgtacttctcaaa
gaccttgaagatttaacttgcatatatgaggattttcttcacaattggttcataagctca
tccctatcaatcgaataa

DBGET integrated database retrieval system