KEGG   Candidatus Liberibacter solanacearum: CKC_05340Help
Entry
CKC_05340         CDS       T01373                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lso00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CKC_05340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lso03011]
    CKC_05340
Ribosome [BR:lso03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CKC_05340
  Bacteria
    CKC_05340
  Archaea
    CKC_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADR52814
UniProt: E4UDY6
Position
complement(1141808..1142206)
Genome map
AA seq 132 aa AA seqDB search
MNEKRAVPRRRRVGDNEANAIASMLRISPQKLNLVAAMIRGKKVSDALADLEFSRKRIAV
EVKKTLRSAIANAENNHDLDIDRLVVSEAYVGKSVVMKRFHCRARQRIGRINKPFSRLSV
IVREVQDERKVV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaaaagggctgtgccaaggcgtcgtcgggtaggagataacgaagctaatgct
attgcaagtatgctccggattagccctcaaaagttaaatcttgttgctgctatgattaga
ggaaaaaaagtttctgatgccctcgcggatcttgagttttcgcgaaaaaggattgctgtt
gaggttaaaaagacgcttcgttctgctattgcgaatgcagaaaataatcatgaccttgat
attgatcgtcttgtagtatcagaggcttatgttggtaagtctgttgttatgaagagattt
cattgtcgtgcacgtcaacgtattggtcgtattaataaacctttctctcgtttgagtgtt
atagttcgtgaagttcaagatgaaagaaaggttgtataa

DBGET integrated database retrieval system