KEGG   Lysinibacillus sphaericus: Bsph_0224
Entry
Bsph_0224         CDS       T00656                                 

Definition
(GenBank) PcrB-like protein
  KO
K07094  putative glycerol-1-phosphate prenyltransferase [EC:2.5.1.-]
Organism
lsp  Lysinibacillus sphaericus
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bsph_0224
Enzymes [BR:lsp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     Bsph_0224
SSDB
Motif
Pfam: PcrB Trp_syntA His_biosynth
Other DBs
NCBI-ProteinID: ACA37855
UniProt: B1HTW4
Position
245606..246172
AA seq 188 aa
MTLDGVLDLLVRVRRFEVPIALEISTIDAITPGYDYYFIPTVLNSDDPKWIKNLHHAAIK
EFGDIMVWDELVAEGYCILNPDCKVAHVTGATTDLSIDDIVAYARMAENFFKLPVFYLEY
SGIYGNPEVVSAVKNELKHTKLFYGGGITSAKQAEEMAQYADTVVVGNIIYEDLKAALAT
VKAVKNTL
NT seq 567 nt   +upstreamnt  +downstreamnt
gtgacattggatggggtattagatttacttgttcgtgttaggcggttcgaagtcccgata
gctttggaaatttcaacgattgatgcgattacaccaggctatgactattactttattccg
acggtcttaaatagtgatgatccaaaatggattaaaaatttgcatcatgcagctattaaa
gaatttggagatattatggtgtgggatgaattagtagcagaaggttattgtattttaaat
ccggattgtaaagtggcacatgtaacaggtgctacaacagatttatcgatagacgatatc
gtagcctatgcacgtatggcagaaaatttctttaaacttccggtgttttatttagagtac
agtggaatttacggaaatccagaagtagtaagtgctgtgaaaaatgaattgaagcacact
aagctcttttatggtggaggcattacatcagccaagcaggcagaggaaatggcacagtat
gcagacacggttgtagttggaaatattatttatgaagatttaaaagctgcacttgcgact
gttaaggctgttaaaaatacgttataa

DBGET integrated database retrieval system