KEGG   Lysinibacillus sphaericus: Bsph_0472Help
Entry
Bsph_0472         CDS       T00656                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00473  D-Alanine metabolism
lsp01100  Metabolic pathways
lsp01503  Cationic antimicrobial peptide (CAMP) resistance
lsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bsph_0472
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bsph_0472
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Bsph_0472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lsp01504]
    Bsph_0472
Enzymes [BR:lsp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     Bsph_0472
Antimicrobial resistance genes [BR:lsp01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    Bsph_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ACA38097
UniProt: B1HVS8
Position
complement(490529..490762)
Genome map
AA seq 77 aa AA seqDB search
MDKQQVLEMLVELCEDEIIVENPDIDLFEEGLLDSFGTINLLVEIENRFNISVPITDFNR
EEWNTPNRIAGKLAERQ
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaacaagttttagaaatgctagtggagttatgtgaagatgaaattattgta
gaaaacccagatatcgatctattcgaggaaggtcttctcgattcttttggtacgattaat
ttattagtggaaattgagaatcgctttaatatttctgtacctatcactgattttaatcga
gaagaatggaatacgccgaatcgtattgcagggaaattagctgaaagacaatga

DBGET integrated database retrieval system