KEGG   Lysinibacillus sphaericus: Bsph_1701Help
Entry
Bsph_1701         CDS       T00656                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00071  Fatty acid degradation
lsp00072  Synthesis and degradation of ketone bodies
lsp00280  Valine, leucine and isoleucine degradation
lsp00310  Lysine degradation
lsp00362  Benzoate degradation
lsp00380  Tryptophan metabolism
lsp00620  Pyruvate metabolism
lsp00630  Glyoxylate and dicarboxylate metabolism
lsp00640  Propanoate metabolism
lsp00650  Butanoate metabolism
lsp00900  Terpenoid backbone biosynthesis
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01120  Microbial metabolism in diverse environments
lsp01130  Biosynthesis of antibiotics
lsp01200  Carbon metabolism
lsp01212  Fatty acid metabolism
lsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsph_1701
   00630 Glyoxylate and dicarboxylate metabolism
    Bsph_1701
   00640 Propanoate metabolism
    Bsph_1701
   00650 Butanoate metabolism
    Bsph_1701
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bsph_1701
   00072 Synthesis and degradation of ketone bodies
    Bsph_1701
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bsph_1701
   00310 Lysine degradation
    Bsph_1701
   00380 Tryptophan metabolism
    Bsph_1701
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bsph_1701
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bsph_1701
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bsph_1701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsp04147]
    Bsph_1701
Enzymes [BR:lsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bsph_1701
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bsph_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ACA39297
UniProt: B1HRL2
Position
1790550..1791740
Genome map
AA seq 396 aa AA seqDB search
MDMINEVVIVSAVRTAIGSFQGTLKDVPAVTLGSIVIKDALARAGVAGEQVDEVIMGNVL
SAGLGQNPARQAAIKAGLPNEVSALTINKVCGSGLKAVHLATQAILAGDAEIIVAGGFEN
MSQAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGITAENLCDMYEISREEQDA
FAARSQQRAEAAIAAGKFENEIVAVEIPQRRGEPIVFDKDEFPRAGVTEESLGKLRPAFK
KDGSVTAANASGINDGAAAIVVMSKKKAQELGIQPMAIITANASAGVDPAIMGTGPVKAV
QKALAKAATTLEEIDVIEANEAFAAQSIAVDRELRFNHDKLNVNGGAIALGHPIGASGAR
ILVTLLHEMEKRDAKIGLATLCIGGGQGVATVVKRP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggacatgataaatgaggtagtaatcgtgagtgctgttcgaacagctataggctcattt
caggggacattaaaagacgtaccagctgtaactctaggtagtattgttattaaggacgct
ttagcacgtgcaggagtagctggggaacaagtcgatgaggtcattatggggaatgtgtta
tcggctggtcttggacaaaatccagctcgtcaggcagcgataaaagctggtttaccaaat
gaggtgtcagcactaacaattaataaagtttgcggatcaggtttaaaggctgtgcattta
gcgacgcaagctattttagctggtgatgctgaaattatcgtggctggaggctttgaaaat
atgagccaagccccttatgttttaaaaaatgcgcgtgaaggcttccgaatgggcgatcaa
aaggttgtggatactatgattcatgatggtctatggtgtgcatttaatgattatcatatg
ggcattacagctgaaaatttatgtgatatgtatgaaatttcgagagaagaacaggatgct
tttgcagcacgttctcagcaacgtgcagaggcagcaattgcagctggtaaatttgaaaat
gaaatcgtcgctgtcgagattccacagcgtaggggagagcctattgtattcgacaaggat
gaatttccgcgtgcaggcgtgacagaggaatctctaggtaagctacgcccagcatttaaa
aaagatggttccgtaacagcggctaatgcttcaggtattaacgatggagctgcggcaatt
gttgtgatgtctaagaaaaaggcgcaagagcttggtattcagccgatggcgattattaca
gccaatgcaagtgcgggagtagatcctgcaattatgggaactggtccagttaaagcagtc
caaaaagcactggctaaggcagcaacaactttagaagaaatcgatgtgattgaagcaaat
gaagcttttgcagcacaatcgattgctgttgatcgtgaattacgctttaatcatgataaa
ctaaatgtaaacgggggcgcgattgctcttggtcacccaattggtgcaagtggagctcgt
attttggtcacactcttacatgagatggaaaagcgtgatgcaaaaataggcttagccact
ttatgtatcggaggtggtcaaggcgtagccacagtagtgaagcgtccttga

DBGET integrated database retrieval system