KEGG   Lysinibacillus sphaericus: Bsph_1818Help
Entry
Bsph_1818         CDS       T00656                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bsph_1818
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bsph_1818
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bsph_1818
    1.1.1.-  
     Bsph_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc UDPG_MGDP_dh_N TrkA_N Pyr_redox_3 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACA39412
UniProt: B1HSE1
Position
1894667..1895716
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDIRVEEVELRTLREDEVKVKVAWAGICGSDLHEYEEGPVFVPVDVKADLT
GEVAPLTMGHEFAGIIEEVGSKVTDLQVGDRVVINPTLTYRNKHEDVDRYDGFNFIGLHG
DGGFAEYVNVPATNIHRLADNLTLQDGALVEPMAVAVQAVKDAGVTLGDSVAVFGAGPIG
LLTVIAAKASGASKVIVLDLSDERLEKAKELGATHAINSGKENPVQAVRAIVADGVDVSF
EVAGVAPTFKQAIDVTKPRGNMMIVSIFARPIEWNPMQLTNTGVNVLSSIVYTPSIFQRT
IDAMSAGQLNPQGIITSQIELDEIVDKGFKTLTSDKSQSKILVSISGEN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgtgaaagatattagagtagaagaggttgaattacgt
actttaagagaagatgaagtgaaagtaaaagtagcatgggctggtatttgtggcagtgat
ttgcatgaatacgaagaaggtccagtttttgtaccagttgatgtgaaagctgatttaaca
ggtgaagttgccccacttacaatgggtcatgaatttgctggtatcatcgaggaagttggt
tctaaagttacggacttacaggtaggagaccgagtggtcatcaatcctactttaacttat
agaaacaaacatgaagatgtcgatcgatatgatggatttaactttataggattacatgga
gacggtggatttgcggaatatgtcaatgtccctgcaacaaatatacaccgtttagcagat
aacttaacattacaagatggtgcactagtagaaccaatggcagtagctgtacaagctgtc
aaagatgctggcgttacattaggagattctgttgcagtatttggagctggcccaatcgga
ttattaacagtcatcgctgcaaaagcatctggtgcaagcaaagtcatcgtattagattta
tctgatgaacgattagaaaaggcaaaagaattgggtgcaacccatgctattaattcaggt
aaagaaaatcctgtacaggcagttcgagcaattgtagcagatggtgttgatgtatctttt
gaggttgctggtgtagctcctacctttaagcaggcaatagatgttacaaaacctcgtggg
aatatgatgatcgtttctatttttgctagaccaattgaatggaatccaatgcaacttaca
aatacaggtgttaatgtactatcatccattgtctatacaccatccatttttcaaagaaca
attgatgcaatgagcgctggtcaactaaatccacaaggaatcattacaagtcaaattgaa
ctagatgaaattgttgacaaaggatttaaaacattaacaagcgacaaatcgcagtctaaa
attttagtttctattagtggagaaaattaa

DBGET integrated database retrieval system