KEGG   Lysinibacillus sphaericus: Bsph_2173Help
Entry
Bsph_2173         CDS       T00656                                 

Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00270  Cysteine and methionine metabolism
lsp00920  Sulfur metabolism
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Bsph_2173
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bsph_2173
Enzymes [BR:lsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Bsph_2173
    2.3.1.46  homoserine O-succinyltransferase
     Bsph_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 DUF1514
Motif
Other DBs
NCBI-ProteinID: ACA39744
UniProt: B1HV33
Position
complement(2236993..2238003)
Genome map
AA seq 336 aa AA seqDB search
MKDYKLYELGDIQLQSGDILPNAVLAYQTYGTLNAEKNNAIVYPTWFAGLHTDNEWLIGT
GKALDPEKYFIIIPNMLGNGLSSSPSNTPAPYHQANFPLISIYDNVRLQHQLVTQKFGIS
KIALVVGWSLGAVQTFQWGASYPEMVERIAPFGGTAMTRPHAKVVFEGMIAALQADSNWK
NGFYTEQPKEGLAAMGRVYAAWGFSQAYYLEQLYQQEGYETLEEYLVDYWDQVFLSFDAN
DLISMLRTGITGNISANSTYDGDFELALSKITARALVMPGSTDLFFPPEDNNYDALHMPN
ARFLPIESKWGHCAGIGQHEPDSEFIDKNLKMLLLE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattataaactttatgaactgggagacattcagctacaatcaggtgacatactg
ccaaatgctgttcttgcctatcaaacatacgggacactaaatgcggaaaagaataatgcc
attgtttatcctacatggtttgcaggcttgcatactgataatgaatggttaatcggaact
ggcaaggcactggacccagaaaagtattttatcatcataccgaatatgcttggcaatgga
ttatcctcttctccaagcaatacaccagcgccctatcatcaagcaaatttcccactcatt
tcaatttatgataatgtgcgactacagcatcaattggttactcaaaagtttggtattagt
aaaatagcactcgtagttggctggtcgttaggggctgtacaaacctttcaatggggagca
agttaccctgagatggtcgaacgaatcgctccattcggagggactgccatgactagaccc
catgccaaggttgtatttgaaggaatgattgctgcccttcaagctgattctaactggaaa
aatggtttttacaccgagcaacctaaagagggattggctgccatgggacgcgtctatgca
gcttggggattctcacaggcttattatttagaacagctctatcagcaagaaggctatgaa
acgctggaggaatacctcgtggattactgggatcaagtgtttttaagctttgacgccaat
gatttaatctccatgctacgtaccggcattactggaaatattagtgccaattcgacgtat
gatggtgatttcgagcttgcattaagcaagattacagctcgtgcattggtcatgccagga
agtactgatcttttctttcctccagaggacaataattatgatgcactacatatgccaaat
gcgcgcttcctccctattgaatcgaagtggggacattgtgcagggattggacagcatgag
ccagattctgaatttattgataaaaacctgaaaatgctcctgcttgaataa

DBGET integrated database retrieval system