KEGG   Lysinibacillus sphaericus: Bsph_3430Help
Entry
Bsph_3430         CDS       T00656                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00860  Porphyrin and chlorophyll metabolism
lsp01100  Metabolic pathways
Module
lsp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bsph_3430
Enzymes [BR:lsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Bsph_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase GATase_5
Motif
Other DBs
NCBI-ProteinID: ACA40922
UniProt: B1HRE2
Position
complement(3354450..3355949)
Genome map
AA seq 499 aa AA seqDB search
MPAKSIMIQGTASDVGKSMICTALCRIFSDDGFKVVPFKSQNMALNSFVTKDGGEIGRAQ
GVQAEAARVVATTDMNPILLKPKQDMMSEVIVHGKHFLNMDAKTYRNNFVQEAMPIVEKS
VRSLQNTYDVIVLEGAGSPAEINLKDRDIANMRMAHLADAAVVLVADIDRGGVFASIVGT
LALLDEAERARVKGLIINKFRGMRELLDDGLAWVEQETGIPVLGVVPYLEVNIEAEDSLA
LSSLRFKKPKPGEFAVDVAMIRLPRISNFTDVDPFFDEPEVGVRLIGKVHELGTPDLLIL
PGTKSTIDDLAWLKAQGFDQAIARLREHGTKIIGICGGFQMLGETLLDPDAVEGNGESAD
GLGLLPMETIFVGNKKTVQMTGTRGQDTLTGYEIHLGRTKILREEVTPFLLLEDGREDGA
VSQDEQVIGTYFHGLFHNRTYTRQLINDIRMKKGLAALPREVKSDAERREDAYNMLASHV
RANLDMKKIYELLSIEVSV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaatcaatcatgattcaaggaacagcttccgatgttggaaaaagtatgatt
tgtacggcgttgtgtcgtatattttcagatgatggctttaaagttgtcccctttaaatcg
caaaatatggcgcttaattcatttgtaacaaaagatggcggagaaattggtcgagcacaa
ggagtacaggctgaagctgcccgtgttgttgcgacgactgatatgaaccctattttgctg
aaaccaaagcaagatatgatgtctgaggtcattgtccacgggaagcattttttaaatatg
gatgccaaaacatatcgcaataattttgtacaggaagccatgcccattgtggaaaaatca
gttcgttcgcttcaaaatacatatgatgtcattgtcttagagggggcaggaagcccagca
gagattaacttaaaggatcgtgatattgctaatatgcgaatggctcatttagcagatgca
gcggttgtccttgttgccgacattgatcgtggtggggtttttgcctcgattgttggtaca
ctggcattgctagatgaagcggagcgagcacgagtgaaagggttaatcatcaataaattt
agaggcatgcgtgaattattggatgatggtttggcatgggtggagcaagaaacaggcatt
cccgtactaggtgttgtgccttatttagaggtcaatattgaagcggaggactcgctcgct
ttatcatcattacgctttaaaaagccaaaaccaggggaatttgctgtcgatgtggcgatg
attcgtttaccccgtatttcaaacttcacagatgttgatccattttttgatgagcctgaa
gtgggagttcgattaattggaaaagttcatgaactcggtacgccagatttgctgatactc
ccaggaacgaaaagtaccatcgatgatttagcctggttaaaggctcaaggcttcgatcaa
gccattgcccgattaagggagcatggcaccaaaattattggaatatgtggtggttttcaa
atgcttggtgagacgctattagatccagatgcagtggagggaaatggtgaatctgctgat
ggtcttggcttattgccgatggaaactattttcgtaggcaataaaaaaacggttcaaatg
actggcacaagaggacaggatactttgacaggctatgaaattcatctagggcgaacaaaa
attttacgtgaagaagttacaccgtttttactgcttgaagatggtcgtgaagatggggct
gttagtcaagacgaacaggtaattggtacgtatttccatggtttatttcataatcgtacc
tatactcgtcagcttatcaatgacatccgtatgaaaaaaggtttagctgctttaccacgt
gaagtaaaaagtgatgctgaacgaagagaagatgcctataacatgttagctagtcatgta
cgagcaaatcttgatatgaaaaaaatatatgaattattatctatagaggtatctgtatga

DBGET integrated database retrieval system