KEGG   Lysinibacillus sphaericus: Bsph_3678Help
Entry
Bsph_3678         CDS       T00656                                 

Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bsph_3678
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bsph_3678
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bsph_3678
    1.1.1.-  
     Bsph_3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N F420_oxidored ADH_N_assoc Methyltransf_24 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACA41162
UniProt: B1HTF8
Position
3586937..3587995
Genome map
AA seq 352 aa AA seqDB search
MMKAARWYKAKDIRVENIDEPVIAPGKVKIKVHWTGICGSDLHEYAAGPIFIPVEQPHYV
SKDIAPIVMGHEFSGEVVEIGDGVTSVKVGDPVVVEPILSCGECAACKKGKYNICKHLGF
HGLSGGGGGFSEFTMVDEKLVHKMPEGLSYEQGALVEPAAVALHAVRQSKLKAGDKAAVF
GTGPIGLLVIEALRAAGASEIYAVELSAERAAKALELGATAVINPKEEDAVARLHELTNG
GVDVAFEVTGVPVVLQQAIDSTTFEGETIIVSIWETDASILPNNIVLTERSVKGIIAYRD
IFPAVMELMKQGYFPADKLVTKRIALEEVVTEGFEALMKERNHIKILVNSQA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcagcaagatggtataaagcaaaagacatccgtgtagaaaatattgatgaa
ccagtcattgcacctggaaaagtaaaaattaaagtacattggacaggaatttgtggtagt
gatttacatgaatacgcagctggtccaatctttattcctgtggagcaacctcactatgta
agtaaagatatcgcgccaattgtaatgggacatgaattctcaggcgaagtagttgaaatt
ggtgatggtgtaacatccgtaaaagtgggagatcctgtcgtagttgaaccgattctttcc
tgtggcgaatgtgctgcctgtaaaaaaggtaaatataatatttgtaagcatttaggcttc
cacggtctttcaggcggtggtggtggattctctgaatttacaatggtagacgaaaaattg
gttcacaaaatgcccgaaggactttcctacgagcaaggcgcattggtcgaacctgcagcg
gtagccctacacgcagtacgccaaagtaaattaaaagcaggcgataaagcagctgtcttt
ggaacaggtccaatcgggcttcttgtcattgaagcgttacgtgctgcaggcgcgtcagag
atatatgccgtagagctttcagcagagcgtgccgctaaagcattagaactaggtgctaca
gcagtgattaatcctaaagaggaggacgcggtagctcgtctacatgaattaacaaatggt
ggcgttgatgtagcatttgaagtaacaggtgttccagtagtattacagcaagctatagat
tccacaacttttgaaggtgaaaccattattgtttctatttgggaaactgacgcatctatt
ctgccaaacaatatcgtactaactgagcgttctgttaaaggtattattgcttatcgcgat
attttcccagcagtgatggaattaatgaagcaaggttacttccctgctgataaacttgta
acaaaacgtatagctcttgaagaggtcgtaacagagggctttgaggcattaatgaaagag
cgaaaccatataaaaatccttgttaattcacaagcttaa

DBGET integrated database retrieval system