KEGG   Lysinibacillus sphaericus: Bsph_3968Help
Entry
Bsph_3968         CDS       T00656                                 

Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00860  Porphyrin and chlorophyll metabolism
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bsph_3968
Enzymes [BR:lsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bsph_3968
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bsph_3968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACA41436
UniProt: B1HVD4
Position
complement(3837750..3838730)
Genome map
AA seq 326 aa AA seqDB search
MTKLQFQRHRRLRANATMRSMVKETYLHKEDLIYPIFVIEGENIKNEVQSMPGVFQFSLD
KLEAEIDEVVALGIPAVILFGLPAEKDAVGTGAFHDHGIVQEATRLIKTRHPELLVIADT
CLCEFTDHGHCGLIEGDQILNDPSLDVLARTAVSQVKAGADIIAPSNMMDGFVAAIRAGL
DEAGFEHIPIMSYAVKYASSYYGPFRDAADGAPQFGDRKSYQMDPSNRLEAFREAESDIE
EGADFLIVKPALSYLDIIRDMKNNYPLPLVAYNVSGEYAMIKAAAINGWIEEKKVVLETL
LGMKRAGSDLIITYHAKDVARWLEEK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactacaatttcaaagacatcgtcgtttgcgtgccaatgcaacgatgcgatca
atggtaaaagaaacatacttacataaagaggacctgatttatcctatttttgtaatagag
ggcgaaaatattaaaaatgaagtacagtctatgcctggtgtttttcaattttcattagat
aaactagaagcagaaattgatgaggttgttgcattaggaatcccagctgtcattttattt
ggtttaccagctgaaaaagatgctgttggaactggtgcattccatgatcatggtattgtc
caagaagcgactcgcttaattaaaacgcgtcaccctgagcttttggtcattgcggataca
tgcttatgtgagtttacggatcacggtcattgcggcctaattgaaggcgatcaaatttta
aatgacccttcattagatgttttagctcgcactgcagtatcacaagtaaaggcaggcgca
gatataattgctccgtctaatatgatggatggttttgttgcggcgattcgtgctgggctt
gatgaagccggctttgaacatattccaatcatgtcatacgcggtgaaatatgcgtcaagt
tactatggcccattccgtgacgcggcggatggtgcaccacaatttggtgatcgtaaatca
tatcaaatggacccatcaaatcgattagaggcattccgtgaggcagaatctgatattgaa
gagggggcggatttcttaattgttaagcctgccctaagttatttagatattatccgagat
atgaaaaataattatccattaccactagtagcgtataatgtttcaggtgagtatgcgatg
attaaagcagctgctattaatggttggattgaagagaaaaaagttgtgcttgaaacatta
ttaggtatgaaacgtgcaggctctgatttaattattacgtatcatgcaaaagatgttgca
cgttggttggaggagaaataa

DBGET integrated database retrieval system