KEGG   Lysinibacillus sphaericus: Bsph_4258Help
Entry
Bsph_4258         CDS       T00656                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00300  Lysine biosynthesis
lsp01100  Metabolic pathways
lsp01120  Microbial metabolism in diverse environments
lsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bsph_4258
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bsph_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACA41717
UniProt: B1HY02
Position
complement(4138064..4139332)
Genome map
AA seq 422 aa AA seqDB search
MNDLHALKMKLVDEVENHQAELIDFCSKLIQIPSVNPPGDTTEITAFIERYLNDVGIVYQ
KYEATDKMFNLVASIGKDEGKELIYCGHTDVVPVGDLSKWDFNPFSGEVKDGWMLGRGAS
DMKAGLAGIIFATKLLKKLNIELPGKLTLAIVPDEETGGEYGVPWLLERGLIKGDGCLIA
EPSSPLNPTIGQKGSFWFELEVHGEPGHGSLSPLAGRNAINDAIRAIQEIRTLWDMNIVI
PEEVQSLIEVSKKYMREVEKDRLKYQEVLEKITVNIGTIEGGTKSNVIPDYCKVQVDCRL
PFGITQEEVTEILKNKLDALDIEYSIRRFGFKSVANYTPAENPVCQSIVENISFVTGLEA
YGVMQWASSDARHFRQYDIPVLQYGPAYLPSIHGYNEKVRVEDIVRCAKVYITAAIDFLY
QK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacttacatgctctaaaaatgaaattagtagatgaagtagaaaatcatcaagca
gagttaattgatttttgttcgaaactcattcaaattccaagtgttaatcccccaggagat
acgactgagataacagcctttatcgagcgctatctaaatgatgtaggcattgtttaccaa
aaatatgaagctactgataaaatgtttaacttagtagcttctattggaaaggatgaaggc
aaagaactaatttattgtgggcatacagatgtcgtgcctgttggagatttatctaaatgg
gattttaatcctttctctggagaagtgaaggatggttggatgcttggtcgtggtgcaagc
gatatgaaggcgggtttagcaggtattatttttgcaacaaaattactcaagaaattgaat
attgaattgccaggaaaattaacattagcaattgtacctgatgaagaaactggtggagaa
tatggtgttccttggttgttggagcgtggtttaataaaaggcgatggatgtttaattgca
gagccttcatctccattaaatccgacaatagggcaaaaagggtccttctggtttgaatta
gaggtgcatggggaaccaggacatggaagcttatcccctttagcaggtcgtaatgcaatt
aatgatgcaatccgtgctattcaagaaattcgcacactatgggacatgaatattgtcatt
cctgaggaagtacagtcactaatagaagtatcgaaaaaatacatgcgtgaagtggagaaa
gaccgcctgaaatatcaagaagtactagagaaaattactgtaaatattggtacaattgag
ggggggacgaaatccaacgttatcccagattattgtaaggtacaggtcgattgtcgctta
ccattcggtattacacaagaagaagtaacagaaatcttgaagaataaattagatgcctta
gacattgagtattcgatcagacgttttggtttcaaaagtgtagccaattataccccagct
gaaaatcctgtttgccaatcgattgtggaaaatatttcatttgtaacagggttagaagct
tatggtgtcatgcaatgggcaagcagtgatgctcgacatttcagacagtatgatattccg
gttttacaatatgggccagcctatttaccaagtattcacgggtataatgaaaaagtgcgt
gttgaggatatcgtacgctgtgcaaaagtatatattactgctgctattgatttcctctat
caaaagtaa

DBGET integrated database retrieval system