KEGG   Lysinibacillus sphaericus: Bsph_4468Help
Entry
Bsph_4468         CDS       T00656                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00010  Glycolysis / Gluconeogenesis
lsp00260  Glycine, serine and threonine metabolism
lsp00680  Methane metabolism
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01120  Microbial metabolism in diverse environments
lsp01130  Biosynthesis of antibiotics
lsp01200  Carbon metabolism
lsp01230  Biosynthesis of amino acids
Module
lsp_M00002  Glycolysis, core module involving three-carbon compounds
lsp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_4468
  Energy metabolism
   00680 Methane metabolism
    Bsph_4468
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsph_4468
Enzymes [BR:lsp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bsph_4468
Membrane trafficking [BR:lsp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bsph_4468
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bsph_4468
  Exosomal proteins of melanoma cells
   Bsph_4468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 SnAC
Motif
Other DBs
NCBI-ProteinID: ACA41919
UniProt: B1HZR0
Position
complement(4335613..4336224)
Genome map
AA seq 203 aa AA seqDB search
MIWDYLMTYYSNKTTFSRREAFMSNIYVIRHCLAQGQSPDAPLTQTGMRQADSLADFFKD
TTIHRILSSPFLRAVQSIEAISKEKGIQIEIDHRLSERLLSTKDLPDWYEKLQATFMDMD
LSFDGGESSKEAMDRIVNVVEEAVARNVENTLLVSHGNIITLLLKHYNKDIDFQCWKDLS
NPDVFVLQVKHNNIVIERVWNPQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggattatttaatgacgtactattctaataaaactactttttcaagacgagag
gcatttatgagtaatatctatgtcattagacattgtcttgcacaagggcaatcacctgac
gcccctttaacacagacaggcatgaggcaagcagatagcttagctgattttttcaaagat
actaccattcatcgaattctctcaagcccctttttacgcgcagtccaatccattgaagct
atcagtaaagaaaagggtattcaaattgaaatagatcatcgattgtctgaacgactttta
agtacaaaagatttgccagattggtacgaaaaattacaggcaacatttatggatatggac
ttatcatttgatgggggagaatccagcaaagaagcaatggaccgcattgtgaatgttgta
gaggaggctgttgctcgaaatgttgaaaataccttactagtgagtcatggcaatatcatc
accttattattgaaacattataataaagatattgattttcaatgttggaaagatttaagt
aatccagatgtttttgtattacaggtaaagcacaataacatcgtaatagaacgggtatgg
aatccacagtag

DBGET integrated database retrieval system