KEGG   Lonchura striata domestica (Bengalese finch): 110467822Help
Entry
110467822         CDS       T05897                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00564  Glycerophospholipid metabolism
lsr00565  Ether lipid metabolism
lsr00590  Arachidonic acid metabolism
lsr00591  Linoleic acid metabolism
lsr00592  alpha-Linolenic acid metabolism
lsr01100  Metabolic pathways
lsr04010  MAPK signaling pathway
lsr04217  Necroptosis
lsr04270  Vascular smooth muscle contraction
lsr04370  VEGF signaling pathway
lsr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110467822 (PLA2G4A)
   00565 Ether lipid metabolism
    110467822 (PLA2G4A)
   00590 Arachidonic acid metabolism
    110467822 (PLA2G4A)
   00591 Linoleic acid metabolism
    110467822 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    110467822 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110467822 (PLA2G4A)
   04370 VEGF signaling pathway
    110467822 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110467822 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110467822 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110467822 (PLA2G4A)
Enzymes [BR:lsr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110467822 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 DUF2281 Folliculin MMU163
Motif
Other DBs
NCBI-GeneID: 110467822
NCBI-ProteinID: XP_021380826
Position
Unknown
AA seq 763 aa AA seqDB search
MSIIDPYQHIVVEHQYSHIFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPTAPDCRKRT
KHFNNDINPVWNETFEFILDPNLENVLEVTLMDANYVMDETLGTSTFPISSLKLGEKKEV
QLTFNNVTEMTLELSLEVCSSTDLRFSMALCDEEKRFRQQRRDNIMHSIKSFLGENSHNL
TTSRDVPVIAVLGSGGGFRAMVGFAGVMKALYESGVLDCATYIAGLSGSTWYMSTLYSHP
DFPAKGPKEINEELMNSVSHNPLLLLTPQKVKRYIEALWNKKSSGQPVTFTDIFGMLIGE
TLIHDRMDTTLSNMKEKINNAQCALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGT
FMSPDLFGSKFFMGTVVKKYTENPLHFLMGEYVSAFSILFNRVLGVSNSHNKGPTMEEEL
ENIRLKHLVSNDSSDSEDESQHPKGTEGAEAKREQQERQQESSQESSQESSQESSQESWV
QRMLMALVGDSALFNTREGRAGKVHNFMLGLNLNSCYPLSPLAELLTQESLEEEEAAAVA
DPDEFERIYEPLDVKSKKIHIVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPP
FKEILLAEKWAKMNKLPFPKIDPNVFDREGLKECYVFKPKDTSSEKDCPTIIHFVLANID
FRKYKAPGIPRETQEEKDFADFDIFDDPDTPFSTFNFQYPNEAFKRLHDLMEFNTLNNMD
VIKEAMMESIEYRKQNPSRCSVSLSSVEARRFFNKSNLNNNHT
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcatagatccttatcaacacattgtggtggaacaccagtactcacacatattc
actgtgacagtaaggaaagccacaaatgtcaccaaaggagccattggtgacatgcttgac
actccagatccctacgtggagctgttcatccccactgcccccgactgcaggaagagaacc
aagcacttcaacaatgacatcaaccccgtgtggaacgagaccttcgagttcattctggac
cccaatctggagaatgttctggaggttactctcatggatgccaactatgttatggatgag
actcttggcacatctacatttcccatctcttctctgaaactgggagagaagaaggaggtc
cagttaactttcaataatgtcacagaaatgactttggaattgtctctggaagtatgctcc
tccacggacctgcggttcagcatggccctgtgcgatgaggagaagaggttccggcagcag
cgcagagacaacatcatgcacagcatcaaatcattcctgggggagaacagccacaacctg
accacctcccgtgatgtgcctgtgatcgccgtgctgggctcaggaggggggttccgagcc
atggtgggctttgctggagtcatgaaagcactttatgagtctggagtcctggactgtgcc
acctacattgctgggctctctggatccacctggtatatgtcaactctgtattcccaccct
gatttcccagccaagggcccaaaggagatcaatgaggagctgatgaactcggtgagccac
aaccccctgctgctgctcacccctcagaaagtcaagcgctacatcgaggctctgtggaac
aagaagagctcagggcagcctgtcaccttcacagacatctttgggatgctcataggggaa
acactgatccatgataggatggacaccactctgagcaatatgaaagagaagatcaataat
gcccagtgtgctctgccactcttcacctgtctgcatgtcaaaccagatgtctcagagctg
atgtttgcagactgggtggaattcagtccatatgaaattggaatggccaagtatggcact
ttcatgtctcctgatctgtttggaagcaagttttttatggggacagtggtgaagaaatat
actgaaaatcccttgcatttcctgatgggtgagtatgtgagtgcattttcaatattattt
aacagagtccttggtgtctccaattctcacaataaagggcctaccatggaagaagaatta
gaaaatattaggctaaagcaccttgtgagcaatgacagctcagacagtgaagatgagtca
cagcatccaaaaggcacggagggcgctgaggcaaagcgggagcagcaggagaggcagcag
gagagcagccaggagagcagccaggagagcagccaggagagcagccaggagagctgggtg
cagcgcatgctgatggccctggtgggggacagcgccctgttcaacacgcgcgagggccgc
gccggcaaggtgcacaacttcatgctggggctgaacctcaacagctgctaccccctgtcc
cctctggcagagctgctcacccaggagtccctggaggaggaggaggcggcagcagtggca
gatcctgacgagtttgagaggatctatgagcccctggatgtgaagagcaagaagatccac
atcgtggacagtgggctgaccttcaacctgccctacccgctcatcctaaggccccagaga
ggcgtggatctcatcatctcctttgatttctcagccaggccaagtgattccagccctcct
ttcaaagaaatcctgctggctgagaaatgggccaaaatgaacaagcttccttttcccaag
atagaccccaacgtgtttgacagggagggcttgaaggagtgctatgttttcaaaccaaag
gacacctcctcggagaaggactgtccaaccatcatccacttcgtgctggccaacatcgac
ttcaggaagtacaaagctccaggcattcccagagaaacacaagaagagaaggattttgca
gactttgatatttttgatgatccagacacacctttctctaccttcaacttccagtatccc
aatgaggctttcaagaggctccatgacctcatggagttcaacaccctcaacaacatggat
gtgatcaaggaggcgatgatggagagcatcgagtacaggaagcagaacccctcgcgctgc
tccgtgtccctcagcagtgtggaggccaggaggttcttcaacaagagcaacctcaacaac
aaccacacgtag

DBGET integrated database retrieval system