KEGG   Lonchura striata domestica (Bengalese finch): 110468655Help
Entry
110468655         CDS       T05897                                 

Gene name
CARS
Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110468655 (CARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lsr01007]
    110468655 (CARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lsr03016]
    110468655 (CARS)
Enzymes [BR:lsr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     110468655 (CARS)
Amino acid related enzymes [BR:lsr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   110468655 (CARS)
Transfer RNA biogenesis [BR:lsr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    110468655 (CARS)
 Prokaryotic type
    110468655 (CARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DUF4484 WGG Senescence_reg
Motif
Other DBs
NCBI-GeneID: 110468655
NCBI-ProteinID: XP_021382421
Position
Unknown
AA seq 831 aa AA seqDB search
MAAAASAEHASSYSFILSISEEEARVEALNEYLSTRSYIQGFTFSHADVEVFRKFSGPPV
DQYIHVVRWYRHIEAIYDGSSEKNEPCILQTSKGKRVQPPWSPPEGTKHSRLCLYNSLTR
SKEVFQPQNGKKVLWYCCGPTVYDASHMGHARSYISFDILRRILRDYFKYDVFYCMNITD
IDDKIIKRARQNHLFERYRESKSTPDQLLEDIRTASELFSVKLNETTDPDKKQMLERIQN
AVKSAFDPLQEALQATLPAEEINRCHETLLEEAKDLLSDWLDTKFGSQVTDNSIFSKLPK
FWEAEFHKDMEALNVLPPDVLTRVSEYVPEIVDFVKKIVDNGYGYVSNGSVYFDTMKFDA
SEKHSYAKLVPEAVGDQKALQEGEGDLSISADRLSEKHSPNDFALWKSSKPGEPSWDSPW
GKGRPGWHIECSAMGGSVLGESMDIHGGGFDLRFPHHDNELAQSEAYFENDHWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHTARQLRLAFLMHSWKDTLDYSNNTMESAIQYEK
FMNEFFLNVKDILRAPTDVTGQFQKWENQEVELNKNFYEKKAAIHEALCDNIDTRSALEE
MRSLVSQSNSYIAAKKSSRQMPNRLLLENISSYLTQMLKIFGAIESDDAIGFPVGGTSQN
TNIESTVMPYLQVLSEFREGVRQIAREKKVTEVLQLSDALRDDILPELGVRFEDHEGLPT
VVKLVDKDTLLKEREEKKKIEEEKKRKKEEAARKKQQQEAAKLEKMKIPPHEMFKLELDK
YSMFDENGFPTHDTEGKELSKGQIKKLKKLYETQEKLHKEYLQMVQNGSAN
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccgccagcgccgagcacgcttccagctacagttttattctgagcattagt
gaagaggaagccagggtggaggctctgaacgagtacctgagcactcgtagttatatccag
gggttcacattttcacatgcagatgtggaggtgttcagaaagttttcggggccacctgtg
gaccagtatatccatgttgtccggtggtacagacacatagaagcaatctatgatggcagc
agtgaaaaaaatgagccttgtatacttcaaacaagtaaaggcaaacgtgtgcagcccccc
tggtctccccctgaagggacaaaacattccaggctctgcctctacaacagcctgactcgc
agtaaggaagtatttcagcctcagaatggaaaaaaggtcttgtggtattgctgtggtcca
acagtttatgatgcttctcacatgggacatgccaggtcttacatctcatttgatatcctg
agaagaatcttgagggattattttaaatatgatgttttctattgtatgaatattacagat
attgatgacaagatcatcaagagagcaagacaaaatcacctttttgaacgatatagagag
agcaaatcaacaccagatcagctactcgaagatattagaactgcctcagagctcttttca
gttaaactaaatgaaacaacagacccagataagaagcaaatgttggaaagaattcaaaat
gcagtgaagtctgcttttgaccctctacaagaagctctccaagcaacgctccctgctgaa
gagatcaacagatgtcatgagacactgttggaagaagccaaagatttgctgtctgactgg
ttggacacaaaatttggcagtcaggtgactgacaattccatattctcaaagctccccaaa
ttctgggaagcggaatttcataaagatatggaagcactcaacgttttacctccagatgtt
ttaacgcgggttagtgaatatgtgccagaaattgtggattttgtgaagaagattgtggat
aatggttatgggtatgtgtccaatggatctgtatactttgatactatgaaatttgatgcc
agtgaaaaacactcctatgctaagttggtgcctgaagctgtaggtgatcagaaagctctt
caagaaggtgaaggtgacctgagcatctcagctgatcgtttaagtgagaagcattctcca
aatgattttgctttatggaagtcctccaagccaggagagccctcatgggactctccatgg
ggaaagggtcgtccaggttggcacattgaatgttctgccatgggtggatccgttctagga
gagtcgatggacattcatggaggaggctttgatcttcgatttcctcaccatgacaatgaa
ctggcccagtctgaggcatattttgaaaatgatcactgggttcggtattttctgcatact
ggtcacttaacaattgctggctgtaaaatgtccaaatctttgaagaatttcattaccata
aaagatgcactgaagaaacacacagcacgacagttacggctggctttcctcatgcactct
tggaaggatacactggattattcaaataataccatggagtcagctattcaatatgagaag
tttatgaatgagttctttttgaatgtgaaggatattcttcgagctcccactgatgtgaca
ggccagtttcagaaatgggaaaatcaagaagtagagctgaacaaaaatttttatgagaag
aaagcagcaattcatgaagcactatgtgacaatattgacacccgctctgccttagaggaa
atgcggtctttagtcagccagagtaactcctatattgctgcaaagaaatcttccagacag
atgccaaacagacttcttttggaaaacatcagctcctatctcactcaaatgctaaagatt
tttggtgccatagaaagtgatgatgcaattggttttcctgttggagggactagtcaaaac
acaaatattgaatctacagtgatgccatacctccaagttctttctgagttcagagaagga
gtgcgacaaatcgccagagaaaagaaagtaactgaagtgctgcagttgagtgatgctctt
cgggatgacatcctgcctgaacttggagttcgatttgaagatcatgaaggacttccaact
gtggttaaattagtggataaggacacattgttgaaagaaagagaagaaaagaaaaagata
gaagaagagaaaaaaaggaagaaagaagaagcagccaggaaaaaacaacagcaggaagca
gcaaaactggaaaaaatgaagattccaccacatgaaatgtttaaattggaacttgacaaa
tattccatgtttgatgaaaatggatttcccacccatgatacagaaggcaaggaacttagc
aaaggacaaattaagaagctaaagaaactttatgaaacccaagaaaagctacacaaggag
tatctacaaatggttcagaatggaagtgcaaattga

DBGET integrated database retrieval system