KEGG   Lonchura striata domestica (Bengalese finch): 110469743
Entry
110469743         CDS       T05897                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lsr03000]
    110469743 (AHRR)
Transcription factors [BR:lsr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110469743 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_11 DUF1505
Other DBs
NCBI-GeneID: 110469743
NCBI-ProteinID: XP_021384462
Position
2
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQDGQMIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVRAKHKADDAAAANTN
SSSKGSSGLSEATELYGRNNHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLTQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSLLGIQNNCTTNSTWTLRNSS
SCSMSQRMSTCPNRRAGSFYSRDQHFLNLASTCPSHWGNTENGQPYSGLQQRCAENYATD
HLKLQRPLISSESLYDTAVPLEMPIKMEYDSDSENIADNYLLSQGRAWLDESSSVRKQVS
SYPNRMHLKTEPDLCEPALPCQKPRHCLYTPHNWQCIIANHPNNLNLNRACKGSRNKEVP
PFCPQNSSVCLESMPDLSHTACYSHFYSPSPGEEKEPVNEVFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRVHTSFPENTLVGPMPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcaaagagacacagagaccgtctg
aatgcggaactggaccacctggccagcctccttccttttccacctgacatcgtatcaaag
ctggacaaactttctgtcttgcgccttagtgtcagctatctccgagtcaaaagtttcttt
caagctattcaagaaaagcactttaagaagcaagatggccaaatgataaaagaagacaat
atatctaacaagactgctgtacaagaaggtggactgctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gaccgccaggatttttgtagacaactgcactgggccatgaatcctccccagatgttgtca
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caagagaatgacagcatgacaacagattattcttcctttttaactcgctgttttatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaagaaagaagtcctcatcaggaacagtattgccacctcag
ctgtctttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgagagcaaaacacaaagctgatgatgcagcagcagcaaacacgaac
tccagttcaaaaggcagttcaggactttctgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcactaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagttaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
acccaacagcaaatgttaaaggaagaagatgagcaactgaagatactaagtggttttgcc
agtttgaaaggaaacctggaggggctttcgtataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttatgcaagaggaacctctgagttctaacacatca
cttttaggcatacaaaacaactgcaccacaaacagtacctggactttaagaaactccagt
tcttgttccatgagccagagaatgagcacgtgtccaaacaggagagctggatcattctac
agcagagaccaacattttttaaatttggcatcaacttgtccttcccactgggggaacaca
gaaaacggccagccttactcggggctccaacagcgctgtgcagagaactatgccacagac
cacctgaagctgcagagaccattaatatcctcagagtctctctatgacacagctgttcct
ttggagatgcctatcaaaatggaatacgactctgattcggaaaacattgctgataactac
ctgctttcgcagggccgagcctggctggatgagagcagctcggtgagaaagcaggtgtcc
agctatcccaacagaatgcacctcaaaacggagccggacctctgtgagccagccttgccg
tgccagaagccaaggcactgcctttacacaccccataattggcaatgcatcatagcaaat
catcccaacaacctcaacttgaacagagcttgcaagggttcacggaacaaggaggtgccc
cccttctgccctcagaactcctctgtgtgtttggaaagcatgcctgacctatcacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagccggttaatgag
gtgttcaaaatgccatgtgaatttaaaaacccctgcttggttcaagcaatcaagcgtgag
cccctggattctccaccattgtccaacagcggacagaacagagtacacacaagcttccct
gaaaatacattagtaggtcctatgcctcataaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system