KEGG   Lonchura striata domestica (Bengalese finch): 110469958Help
Entry
110469958         CDS       T05897                                 

Gene name
AMT
Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00260  Glycine, serine and threonine metabolism
lsr00630  Glyoxylate and dicarboxylate metabolism
lsr00670  One carbon pool by folate
lsr01100  Metabolic pathways
lsr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110469958 (AMT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110469958 (AMT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    110469958 (AMT)
Enzymes [BR:lsr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     110469958 (AMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C DUF5005
Motif
Other DBs
NCBI-GeneID: 110469958
NCBI-ProteinID: XP_021384890
Position
Unknown
AA seq 403 aa AA seqDB search
MLRAGCRAALPRRPPGSAPRSGAGGAGAGEEGLKQTPLDALHRARGGRMVPFAGWTLPLH
YGQGHLQSHLHTRRHCSLFDVSHMLQTLVYGRDRIRFMESLVVGDIAELKPGQGTLTLLT
NEKGGIMDDLIVTNTSEDHLYVVSNAACADKDLAILRDRAAQLQATGSDVHLEVSDNALL
ALQGPSMARVLQAGLSDDLAKLSFMNSITTTVFGVPGCRVTRCGYTGEDGVEISVPAARA
VELAEQLLGVPDVWLAGLAARDSLRLEAGLCLYGNDIDETVTPAEAGLMWTLGKRRRVAM
DFPGAAVIMAQVKEKPRRRRVGLTSVGPAIRPHMAILGPEGRPVGTVTSGCPSPCLGKNI
AMGYVEAAHSRAGTELTVEVRKKQHPAVITKMPFVPTQYYMAK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcgggctgccgcgccgcgctgccccgccgccccccgggctcggcgccgcgg
agcggggccgggggcgccggggccggggaggaggggctgaagcagacgccgctggatgcc
ctgcaccgggcccgcggcgggcggatggtgccgttcgccggctggacccttccgctgcac
tacgggcagggccacctccagtcacacctgcacacccgccgccactgctccctcttcgac
gtctcccatatgctgcagaccctggtctacggccgggaccgcatcaggttcatggagagc
ctggtagtgggggacatcgccgagctgaagccaggacagggcaccctgacgctgctcacc
aacgagaagggcggcatcatggacgacctaatcgtcacaaacacgtcagaagatcacctc
tacgtggtgtccaacgccgcctgtgctgacaaggacttggccatcttgagggacagagcg
gcgcagctgcaggccaccggcagtgacgtacacctggaggtgtcagacaacgcgctgctg
gctctgcaaggtccctccatggcacgggttctgcaggcagggctgtcggatgacctggcc
aagctctcctttatgaatagcatcaccacgaccgtctttggcgtgccgggctgccgggtc
acgcgctgtggttacaccggcgaggatggcgtggagatctcggtgcccgcagcgcgggcg
gtggagctggccgagcagctcctgggtgtccccgatgtgtggctagcagggctggcagcc
agggacagcctgcgcctggaggccgggctctgcctctacggcaatgatattgatgagact
gtcacccctgccgaggccgggctgatgtggactttggggaagcgccggcgtgtggccatg
gacttccccggtgctgctgtcatcatggcacaagtgaaagagaagccaaggcgcaggcgt
gtggggctgacgtcggtgggacccgccatccggccccacatggccatcctgggccccgaa
ggcaggcctgtgggcacagtgaccagtggatgtccctcgccctgcctgggcaagaacatc
gccatgggctatgtggaggcagcacacagccgggctggcaccgagctcactgtcgaggtg
cggaagaagcagcatcctgctgtcatcaccaagatgccctttgtgcccacccagtactac
atggccaagtga

DBGET integrated database retrieval system