KEGG   Lonchura striata domestica (Bengalese finch): 110470157
Entry
110470157         CDS       T05897                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00230  Purine metabolism
lsr00240  Pyrimidine metabolism
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110470157 (DCK)
   00240 Pyrimidine metabolism
    110470157 (DCK)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110470157 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 DUF5066
Other DBs
NCBI-GeneID: 110470157
NCBI-ProteinID: XP_021385256
Position
4
AA seq 257 aa
MATPPKRSRPDGRLRKVAVEGNIAAGKSTFVNILKQASEEWEVVPEPVARWCNVQQSSGD
DCEELSTSQRSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLGALEHKRGDAQNPAVFF
ERSVYSDRYIFAANLYESDCMNETEWAIYQDWHDWMNKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTNFDYLQEIPILTLDVNEDFKGKK
DRYDHMIEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgcagccggcccgacggccgcctcaggaaggtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatattctgaaacaagccagtgaggag
tgggaagtggttcccgagcctgtagctagatggtgcaatgttcagcaaagctctggagac
gactgtgaggagctgagcacatcacagaggagcggcgggaacgttctgcggatgatgtac
gagaagccggagcgctgggccttcaccttccagacgtacgcctgcctcagcaggatccgg
gctcagctcggcgccctggagcacaagcgcggggacgcgcagaatcccgcggtgttcttt
gagcgctccgtctacagcgacaggtacatctttgctgctaatttatacgagtctgactgc
atgaacgagaccgagtgggcaatttaccaggactggcacgactggatgaataaacagttt
ggctcgaggctggctctggatgggatcatttatctccgagccactcctgagaaatgtttg
aataggatttacttgcgtggaagagatgaggaacaagaaatccccattgaatatctggag
aagcttcactacaaacatgaaagctggctccagcacaggacactgcgaacaaattttgac
tatcttcaggaaattccgattttaacgcttgatgttaacgaagacttcaaaggcaaaaag
gacagatatgatcacatgatcgaaaaggtcaaagaatttttgagcactttgtaa

DBGET integrated database retrieval system