KEGG   Lonchura striata domestica (Bengalese finch): 110470179Help
Entry
110470179         CDS       T05897                                 

Gene name
AMDHD2
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase isoform X1
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00520  Amino sugar and nucleotide sugar metabolism
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110470179 (AMDHD2)
Enzymes [BR:lsr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     110470179 (AMDHD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 110470179
NCBI-ProteinID: XP_021385309
Position
Unknown
AA seq 409 aa AA seqDB search
MPSNKSVSDAPIVQFTNCRILRDHQLQREDLWVREGKILNPEKLFFDEKGSADVQLDCKD
SIIAPGFIDVQINGGFGVDFSLATDDFKSGIDLVSQKILSHGVTSFCPTLVTSPPSVYHQ
VLPQISVRNGGAHGAGILGAHLEGPFISKEKKGAHPEHCLRTFEAGAFQDLLATYGSLDC
VQIVTLAPEMRRSSEVIRELTKRGICVSLGHSVANLSQAEEAVQHGATFITHLFNAMLPF
HHRDPGIVGLLTSDKIPSGRRVFYGMISDGIHTNPAALRIAHRAHPKGLVLVTDAIAGMG
LAPGRHTLGQQVVEIDGLNTYIAGTKTLSGSVATMDTCVRHFQEATGCSVETALEAASLH
PAQLLGIEHKKGTLNYDSDADFLMLNDSLYVRATYIAGEEVWRQDVLGM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacaaatccgtctcggacgcgcccatcgtccagttcaccaactgccgcatc
ctgagggaccaccagctccagagggaggacctgtgggtacgagaggggaagatccttaac
ccagagaaactcttctttgacgaaaagggctctgctgatgtccagctggactgcaaggac
agcatcatcgccccaggtttcatcgatgtccagatcaatggaggcttcggggtggacttc
tctctggctacagatgacttcaaatcaggtattgacctggtcagtcagaaaatcctctcc
catggagtgacctctttctgtcccaccctggtgacctctcctccatctgtataccaccag
gttctccctcagatcagtgtaagaaatgggggagcccatggagcaggaatcctgggagcc
cacctggaggggccgttcatcagcaaggagaaaaagggtgcccacccggagcactgcctc
cgcacctttgaggcaggtgctttccaggacctgcttgccacctacggctccctggactgt
gtccagatagtgaccctggcccctgaaatgaggaggagcagtgaggtgatccgggagctc
accaagcggggcatctgcgtctccctgggtcactcagtggctaatctgtcccaggccgag
gaggctgtgcagcacggagcaaccttcatcactcacctcttcaatgccatgctgccgttc
caccaccgtgaccctggcattgtggggctgctgacaagtgacaagattccttctgggcgg
agggtcttctatggcatgatttctgatggcatccacaccaaccctgctgccctgcgcatt
gcccaccgagcccaccccaaagggctggtgctggtgacagatgcaattgctggcatgggg
ctagcaccgggtcggcacacactgggtcagcaggtggtggagatcgatgggctgaacacg
tacatcgcaggcacaaagaccctgagtggcagcgtggcgaccatggacacttgtgtgcga
cacttccaagaagccacagggtgctcagtagagactgcgttggaggcagcatctctgcat
cccgctcagctcctggggattgaacataaaaaggggacactgaattatgactccgatgca
gatttcctaatgctgaatgacagcctgtatgtgcgagccacatacattgccggcgaggaa
gtctggcgacaggatgtcttgggcatgtga

DBGET integrated database retrieval system